DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12081 and ACBP4

DIOPT Version :9

Sequence 1:NP_001259343.1 Gene:CG12081 / 31799 FlyBaseID:FBgn0030053 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_974227.1 Gene:ACBP4 / 819707 AraportID:AT3G05420 Length:669 Species:Arabidopsis thaliana


Alignment Length:418 Identity:105/418 - (25%)
Similarity:161/418 - (38%) Gaps:98/418 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 WTVHLDGGPQ---RVNHAAVGVGDFIYSFGGYCTGYDYRYNEPIDVHALNAHTMRWTLVPQQLDD 64
            ||.....|.:   |..|.|..:.|.:|.:||...|   ||..  |:|.|:..:..|:.|..::..
plant   172 WTAPQTSGQRPKARYEHGAAVIQDKMYIYGGNHNG---RYLG--DLHVLDLKSWTWSRVETKVAT 231

  Fly    65 AGVPLKYPLVPFQRYGHTVVAYKDRIYIWGGR-NDENLCNTLYCFDPKTAQWSRPQVTGCLPGAR 128
            .......|.:.....||:::|:.:::...||. .|.:....:..|||.|..||..:..|..|.:|
plant   232 ESQETSTPTLLAPCAGHSLIAWDNKLLSIGGHTKDPSESMQVKVFDPHTITWSMLKTYGKPPVSR 296

  Fly   129 DGHSACVIGNSMYIFGGFVDEINEFSSDVHSLNLDTMEWRYVQTFGVPPSYRDFHASVAYEQERM 193
            .|.|..::|.::.|||| .|......:|:|.|:||||.|..:...||.||.|..||:..:.:..:
plant   297 GGQSVTMVGKTLVIFGG-QDAKRSLLNDLHILDLDTMTWDEIDAVGVSPSPRSDHAAAVHAERFL 360

  Fly   194 YIFGGRGDKHSPYHSQEETYCHEIVYLDMKTKVWHRPFTAGKVPVGRRSHSMFVYNKLIYVFGGY 258
            .||||                                          .||:..            
plant   361 LIFGG------------------------------------------GSHATC------------ 371

  Fly   259 NGLLDQHFNDLYTFDPRTKLWNLIRANGKAPTARRRQCAIVMGTRMFLFGGTSPRSGSSSSPAAV 323
                   |:||:..|.:|..|:.....|.|||.|.....:.:|...|:.||...:||:|.|....
plant   372 -------FDDLHVLDLQTMEWSRPAQQGDAPTPRAGHAGVTIGENWFIVGGGDNKSGASESVVLN 429

  Fly   324 SPTQETGGAAAAGGVVP---PGVALI--DYSDLHVLDFEPTLKTLATMVVL-----KHQLDISGL 378
            ..|......|:..|.||   .|::|:  .|:...||            |..     ::..:|:.|
plant   430 MSTLAWSVVASVQGRVPLASEGLSLVVSSYNGEDVL------------VAFGGYNGRYNNEINLL 482

  Fly   379 PRSFRSDLQMLT----QPNSISRPINQA 402
            ..|.:|.||..|    .|.|:| .:|.|
plant   483 KPSHKSTLQTKTLEAPLPGSLS-AVNNA 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12081NP_001259343.1 KELCH repeat 13..69 CDD:276965 15/55 (27%)
Kelch_6 13..60 CDD:290672 15/46 (33%)
KELCH repeat 78..125 CDD:276965 13/47 (28%)
Kelch_1 78..117 CDD:279660 11/39 (28%)
KELCH repeat 128..170 CDD:276965 17/41 (41%)
Kelch_3 137..188 CDD:290151 21/50 (42%)
KELCH repeat 180..236 CDD:276965 7/55 (13%)
Kelch_3 192..248 CDD:290151 6/55 (11%)
Kelch_5 237..276 CDD:290565 6/38 (16%)
ACBP4NP_974227.1 ACBP 14..99 CDD:279259
PLN02153 171..416 CDD:177814 77/310 (25%)
Kelch_1 184..225 CDD:279660 14/45 (31%)
KELCH repeat 185..241 CDD:276965 16/60 (27%)
Kelch_6 244..296 CDD:290672 14/51 (27%)
KELCH repeat 245..293 CDD:276965 13/47 (28%)
KELCH repeat 296..337 CDD:276965 17/41 (41%)
Kelch_3 305..355 CDD:290151 21/50 (42%)
KELCH repeat 347..395 CDD:276965 16/108 (15%)
Kelch_3 357..406 CDD:290151 17/109 (16%)
Kelch_5 395..432 CDD:290565 11/36 (31%)
KELCH repeat 398..440 CDD:276965 10/41 (24%)
Cortex-I_coil 552..639 CDD:286397
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 40 1.000 Domainoid score I4832
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933937at2759
OrthoFinder 1 1.000 - - FOG0001118
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.