| Sequence 1: | NP_001259343.1 | Gene: | CG12081 / 31799 | FlyBaseID: | FBgn0030053 | Length: | 403 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_005169361.1 | Gene: | hcfc1a / 564853 | ZFINID: | ZDB-GENE-030912-10 | Length: | 1802 | Species: | Danio rerio |
| Alignment Length: | 253 | Identity: | 73/253 - (28%) |
|---|---|---|---|
| Similarity: | 120/253 - (47%) | Gaps: | 20/253 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 74 VPFQRYGHTVVAYKDRIYIWGGRNDENLCNTLYCFDPKTAQWSRPQVTGCLPGARDGHSACVIGN 138
Fly 139 SMYIFGGFVDEINEFSSDVHSLNLDTMEWRYVQ----TFGVPPSYRDFHASVAYEQERMYIFGGR 199
Fly 200 GDKHSPYHSQEETYCHEIVYLDMK----TKVWHRPFTAGKVPVGRRSHSMFVYNKLI------YV 254
Fly 255 FGGYNGLLDQHFNDLYTFDPRTKLWNLIRANGKAPTARRRQCAIVMGTRMFLFGGTSP 312 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG12081 | NP_001259343.1 | KELCH repeat | 13..69 | CDD:276965 | |
| Kelch_6 | 13..60 | CDD:290672 | |||
| KELCH repeat | 78..125 | CDD:276965 | 17/46 (37%) | ||
| Kelch_1 | 78..117 | CDD:279660 | 14/38 (37%) | ||
| KELCH repeat | 128..170 | CDD:276965 | 11/41 (27%) | ||
| Kelch_3 | 137..188 | CDD:290151 | 18/54 (33%) | ||
| KELCH repeat | 180..236 | CDD:276965 | 13/59 (22%) | ||
| Kelch_3 | 192..248 | CDD:290151 | 14/59 (24%) | ||
| Kelch_5 | 237..276 | CDD:290565 | 12/44 (27%) | ||
| hcfc1a | XP_005169361.1 | PLN02153 | 12..332 | CDD:177814 | 73/253 (29%) |
| Kelch_1 | 31..68 | CDD:279660 | 12/37 (32%) | ||
| KELCH repeat | 32..79 | CDD:276965 | 17/47 (36%) | ||
| KELCH repeat | 83..133 | CDD:276965 | 13/50 (26%) | ||
| Kelch_3 | 90..144 | CDD:290151 | 18/55 (33%) | ||
| KELCH repeat | 199..252 | CDD:276965 | 16/55 (29%) | ||
| Kelch_3 | 214..262 | CDD:290151 | 15/50 (30%) | ||
| KELCH repeat | 254..318 | CDD:276965 | 7/21 (33%) | ||
| Kelch_3 | 263..329 | CDD:290151 | 5/12 (42%) | ||
| Kelch_5 | 318..>350 | CDD:290565 | |||
| FN3 | <1624..1653 | CDD:238020 | |||
| FN3 | 1659..1763 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1494 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.940 | |||||