DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12081 and Fbxo42

DIOPT Version :10

Sequence 1:NP_572494.1 Gene:CG12081 / 31799 FlyBaseID:FBgn0030053 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_611647.1 Gene:Fbxo42 / 37532 FlyBaseID:FBgn0034704 Length:667 Species:Drosophila melanogaster


Alignment Length:366 Identity:77/366 - (21%)
Similarity:122/366 - (33%) Gaps:118/366 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 MRWTLVPQQLDDAGVPLKYPLVPF--QRYGHTVVAYKDRIYIW-GGRNDENLCNTLYCFDPKTAQ 114
            :||.:..||..:.|..   .|:.|  .|:.|:.|...:.:|:: ||.:.:...|.|:.||....:
  Fly    79 LRWEVFSQQTVNGGAG---ALLSFIAGRFAHSAVRQDNSMYVFGGGSSSDTTFNDLWRFDLTHMR 140

  Fly   115 WSRPQVTGCLPGARDGHSACVIGNSMYIFGGFVDEINEFSSDVHSLNLDTMEWRYVQTFGVPPSY 179
            |:||..||..|..:...|.....|.:.:|||                     |||       ||.
  Fly   141 WARPVATGTYPSPKGSASMVAWRNQLILFGG---------------------WRY-------PSL 177

  Fly   180 RDFHASVAYEQERMYIFGGRGDKHSPYHSQEETYC--HEIVYLDMKTKVW-HRPFTAGKVPVGRR 241
                                   |.||    :.:|  .|:.|.|:....| .|...:...|:.  
  Fly   178 -----------------------HPPY----QPWCLFDELHYYDLGKNRWLLRSSLSSPPPMA-- 213

  Fly   242 SHSMFVYNKLIYVFGGYNGLLDQ---HFNDLYTFD-PRTKLWNLIRANGKAPTARRRQCAIVMGT 302
            .||..|:...:.|||||. :.|.   :.||.:..| |..:.|..:......|:.|..|..:.:|.
  Fly   214 GHSATVHGDRMVVFGGYQ-IKDDFNVNSNDTWVLDLPEQRWWQPLFVGNTRPSPRYGQIQVELGR 277

  Fly   303 RMFLFGGTSPRSGSSSSPAAVSPTQETGGAAAAGGVVPPGVALIDYSDLHVLDFEPTLKTLATMV 367
            ...|.                     .||...|..|         |:|..:||....:.:..::.
  Fly   278 NHLLI---------------------VGGCGGANRV---------YTDAWLLDMTRDVWSWKSIA 312

  Fly   368 V-----------------LKHQLDISGLPRSFRSDLQMLTQ 391
            |                 :.:.|.:.|...:...|.||:.|
  Fly   313 VRNKRFGAVHMWCNPGCKVNNYLVVVGPSPNMPQDFQMMKQ 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12081NP_572494.1 NanM 13..306 CDD:442289 61/262 (23%)
KELCH repeat 13..69 CDD:276965 5/15 (33%)
KELCH repeat 78..125 CDD:276965 15/47 (32%)
KELCH repeat 128..170 CDD:276965 7/41 (17%)
KELCH repeat 180..236 CDD:276965 9/58 (16%)
Fbxo42NP_611647.1 F-box_FBXO42 24..61 CDD:438882
NanM <101..307 CDD:442289 63/293 (22%)
KELCH repeat 103..148 CDD:276965 13/44 (30%)
KELCH repeat 154..209 CDD:276965 19/109 (17%)
KELCH repeat 212..257 CDD:276965 14/47 (30%)
KELCH repeat 267..314 CDD:276965 12/76 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.