DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12081 and Klhdc9

DIOPT Version :9

Sequence 1:NP_001259343.1 Gene:CG12081 / 31799 FlyBaseID:FBgn0030053 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001101820.1 Gene:Klhdc9 / 360878 RGDID:1561025 Length:350 Species:Rattus norvegicus


Alignment Length:303 Identity:67/303 - (22%)
Similarity:106/303 - (34%) Gaps:98/303 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GGPQRVNH-AAVGVGDFIYSFGGYCTGYDYRYNEPID-------VHALNAHT---MRWTLVPQQL 62
            |||.|.:| ||:..|.::...||:            |       |.||:..:   ..||..|...
  Rat    75 GGPLRSHHDAALVGGRWLCVVGGW------------DGSRRLSTVAALDTSSGVWEVWTAKPANC 127

  Fly    63 DDAGVPLKYPLVPFQRYGHTVVAYKDRIY----IWGGRNDENLCNTLYC--FDPKTAQWSRPQVT 121
            ..||:.           .||.....||.:    ..||...:....::|.  .|..|..:...: .
  Rat   128 PPAGLS-----------SHTCTRISDREFRVSGREGGTRTQRRYGSIYTLKLDHSTRTYCYKE-E 180

  Fly   122 GCLPGARDGHSACVI-------GNSMYIFGGFVDEINEFSSDVHSLNLDTMEWRYVQTFGVPPSY 179
            ||...:|.||.|.::       |:.:.:|||    .|....:|..      :|.       |...
  Rat   181 GCHTASRSGHCAALLPTAGPHPGHQLLLFGG----CNSVGPEVAG------QWS-------PGKI 228

  Fly   180 RDFHASVA---YEQERMYIFGGRGDKHSP----YHS------------------QEETYCHEIVY 219
            :: .|.||   .||....:..|:|.:..|    :||                  ..:|.|:::..
  Rat   229 KE-EAPVAPRLTEQLANLVSSGQGLQQGPQSLRHHSCSVVGPFAVLFGGETLTRARDTICNDLYI 292

  Fly   220 LDMKTK--VW-HRPFT-AGKVPVGRRSHSMFVYNKLIYVFGGY 258
            .|.:..  :| |.|.| .|...||   |...::|..:|:.||:
  Rat   293 YDTRKSPPLWFHFPCTDRGLKRVG---HRTCLWNDQLYLVGGF 332

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG12081NP_001259343.1 KELCH repeat 13..69 CDD:276965 16/66 (24%)
Kelch_6 13..60 CDD:290672 13/57 (23%)
KELCH repeat 78..125 CDD:276965 11/52 (21%)
Kelch_1 78..117 CDD:279660 9/44 (20%)
KELCH repeat 128..170 CDD:276965 11/48 (23%)
Kelch_3 137..188 CDD:290151 11/53 (21%)
KELCH repeat 180..236 CDD:276965 18/84 (21%)
Kelch_3 192..248 CDD:290151 16/81 (20%)
Kelch_5 237..276 CDD:290565 7/22 (32%)