Sequence 1: | NP_001259343.1 | Gene: | CG12081 / 31799 | FlyBaseID: | FBgn0030053 | Length: | 403 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006724878.1 | Gene: | HCFC1 / 3054 | HGNCID: | 4839 | Length: | 2080 | Species: | Homo sapiens |
Alignment Length: | 254 | Identity: | 77/254 - (30%) |
---|---|---|---|
Similarity: | 122/254 - (48%) | Gaps: | 22/254 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 74 VPFQRYGHTVVAYKDRIYIWGGRNDENLCNTLYCFDPKTAQWSRPQVTGCLPGARDGHSACVIGN 138
Fly 139 SMYIFGGFVDEINEFSSDVHSLNLDTMEWRYVQT----FGVPPSYRDFHASVAYEQERMYIFGGR 199
Fly 200 GDKHSPYHSQEETYCHEIVYLDMK----TKVWHRPFTAGKVPVGRRSHSMFVY-------NKLIY 253
Fly 254 VFGGYNGLLDQHFNDLYTFDPRTKLWNLIRANGKAPTARRRQCAIVMGTRMFLFGGTSP 312 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12081 | NP_001259343.1 | KELCH repeat | 13..69 | CDD:276965 | |
Kelch_6 | 13..60 | CDD:290672 | |||
KELCH repeat | 78..125 | CDD:276965 | 18/46 (39%) | ||
Kelch_1 | 78..117 | CDD:279660 | 15/38 (39%) | ||
KELCH repeat | 128..170 | CDD:276965 | 11/41 (27%) | ||
Kelch_3 | 137..188 | CDD:290151 | 17/54 (31%) | ||
KELCH repeat | 180..236 | CDD:276965 | 13/59 (22%) | ||
Kelch_3 | 192..248 | CDD:290151 | 14/59 (24%) | ||
Kelch_5 | 237..276 | CDD:290565 | 15/45 (33%) | ||
HCFC1 | XP_006724878.1 | PLN02153 | 12..330 | CDD:177814 | 77/254 (30%) |
Kelch_1 | 32..69 | CDD:279660 | 13/37 (35%) | ||
KELCH repeat | 33..80 | CDD:276965 | 18/47 (38%) | ||
KELCH repeat | 84..134 | CDD:276965 | 12/50 (24%) | ||
Kelch_3 | 91..145 | CDD:290151 | 17/55 (31%) | ||
Kelch_5 | 134..179 | CDD:290565 | 10/45 (22%) | ||
KELCH repeat | 137..196 | CDD:276965 | 13/59 (22%) | ||
KELCH repeat | 200..253 | CDD:276965 | 19/56 (34%) | ||
Kelch_3 | 215..263 | CDD:290151 | 17/51 (33%) | ||
KELCH repeat | 255..319 | CDD:276965 | 8/21 (38%) | ||
Kelch_3 | 264..330 | CDD:290151 | 6/12 (50%) | ||
Kelch_5 | 319..>351 | CDD:290565 | |||
KELCH repeat | 322..367 | CDD:276965 | |||
FN3 | <1901..1930 | CDD:238020 | |||
FN3 | 1936..2041 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1494 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.940 |