| Sequence 1: | NP_001259343.1 | Gene: | CG12081 / 31799 | FlyBaseID: | FBgn0030053 | Length: | 403 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_037452.1 | Gene: | HCFC2 / 29915 | HGNCID: | 24972 | Length: | 792 | Species: | Homo sapiens |
| Alignment Length: | 263 | Identity: | 79/263 - (30%) |
|---|---|---|---|
| Similarity: | 124/263 - (47%) | Gaps: | 22/263 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 74 VPFQRYGHTVVAYKDRIYIWGGRNDENLCNTLYCFDPKTAQWSRPQVTGCLPGARDGHSACVIGN 138
Fly 139 SMYIFGGFVDEINEFSSDVHSLNLDTMEWRYVQTF----GVPPSYRDFHASVAYEQERMYIFGGR 199
Fly 200 GDKHSPYHSQEETYCHEIVYLDMK----TKVWHRPFTAGKVPVGRRSHSMFVYNK------LIYV 254
Fly 255 FGGYNGLLDQHFNDLYTFDPRTKLWNLIRANGKAPTARRRQCAIVMGTRMFLFGGTSPRSG--SS 317
Fly 318 SSP 320 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG12081 | NP_001259343.1 | KELCH repeat | 13..69 | CDD:276965 | |
| Kelch_6 | 13..60 | CDD:290672 | |||
| KELCH repeat | 78..125 | CDD:276965 | 17/46 (37%) | ||
| Kelch_1 | 78..117 | CDD:279660 | 14/38 (37%) | ||
| KELCH repeat | 128..170 | CDD:276965 | 10/41 (24%) | ||
| Kelch_3 | 137..188 | CDD:290151 | 15/54 (28%) | ||
| KELCH repeat | 180..236 | CDD:276965 | 13/59 (22%) | ||
| Kelch_3 | 192..248 | CDD:290151 | 15/59 (25%) | ||
| Kelch_5 | 237..276 | CDD:290565 | 15/44 (34%) | ||
| HCFC2 | NP_037452.1 | PLN02193 | <2..262 | CDD:177844 | 73/248 (29%) |
| KELCH repeat | 23..69 | CDD:276965 | 17/46 (37%) | ||
| Kelch 1 | 34..79 | 14/45 (31%) | |||
| Kelch 2 | 83..130 | 13/47 (28%) | |||
| KELCH repeat | 127..186 | CDD:276965 | 13/59 (22%) | ||
| Kelch_3 | 136..198 | CDD:290151 | 15/61 (25%) | ||
| KELCH repeat | 190..241 | CDD:276965 | 17/53 (32%) | ||
| Kelch 3 | 207..255 | 16/50 (32%) | |||
| Kelch_3 | 207..253 | CDD:290151 | 15/48 (31%) | ||
| KELCH repeat | 245..312 | CDD:276965 | 12/31 (39%) | ||
| Kelch_3 | 254..323 | CDD:290151 | 9/22 (41%) | ||
| Kelch 4 | 257..303 | 8/19 (42%) | |||
| Kelch_5 | 312..354 | CDD:290565 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 399..447 | ||||
| FN3 | <618..672 | CDD:238020 | |||
| FN3 | 678..778 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1494 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.940 | |||||