DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12081 and klhdc1

DIOPT Version :9

Sequence 1:NP_001259343.1 Gene:CG12081 / 31799 FlyBaseID:FBgn0030053 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_021336373.1 Gene:klhdc1 / 101883226 -ID:- Length:230 Species:Danio rerio


Alignment Length:216 Identity:54/216 - (25%)
Similarity:87/216 - (40%) Gaps:49/216 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 QRYGHTVVAYKDRIYIWGG----RNDENLC--NTLYCFDPKTAQWSRPQVTGCLPGARDGHSACV 135
            :|.||...|.:..:|||||    .:.|...  :.::.:|.:...|...||.|..|....|.|:|:
Zfish    36 ERSGHAAAADRQHLYIWGGYASVADQEQFLPRDEIWIYDLERGSWCVRQVCGSAPPPLSGSSSCL 100

  Fly   136 IGNSMYIFGGFVDEINEFSSDVHSLNLDTMEW---RYVQTFGVPPSYRDFHASVAYEQERMYIFG 197
            :...::||||..|:..  :::::|::|....:   |.....|.|||.||......:| .|:..||
Zfish   101 LDGELFIFGGCSDDGQ--TNELYSISLGDGRFTCRRVTHRSGSPPSPRDKLCCWLHE-GRIVFFG 162

  Fly   198 GRGDKHSPYHSQEETYCHEIVYLDMKTKVWHRPFTAGKVPVGRRSHSMFVYNKLIYVFGGYNGLL 262
            |.|.|          ...|:..|...| |....:..|                   ||.|:|   
Zfish   163 GYGPK----------LLREVGDLQSFT-VDEASWADG-------------------VFWGWN--- 194

  Fly   263 DQHFNDLYTFDPRTKLWNLIR 283
                |:.:.|||..:.|..::
Zfish   195 ----NETHQFDPERRSWTEVQ 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12081NP_001259343.1 KELCH repeat 13..69 CDD:276965
Kelch_6 13..60 CDD:290672
KELCH repeat 78..125 CDD:276965 15/52 (29%)
Kelch_1 78..117 CDD:279660 12/44 (27%)
KELCH repeat 128..170 CDD:276965 11/44 (25%)
Kelch_3 137..188 CDD:290151 14/53 (26%)
KELCH repeat 180..236 CDD:276965 14/55 (25%)
Kelch_3 192..248 CDD:290151 11/55 (20%)
Kelch_5 237..276 CDD:290565 8/38 (21%)
klhdc1XP_021336373.1 KELCH repeat 37..89 CDD:276965 15/51 (29%)
Kelch_5 37..75 CDD:316377 10/37 (27%)
NanM 91..>210 CDD:330881 38/158 (24%)
KELCH repeat 93..143 CDD:276965 12/51 (24%)
KELCH repeat 146..210 CDD:276965 23/101 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933937at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.