| Sequence 1: | NP_001259343.1 | Gene: | CG12081 / 31799 | FlyBaseID: | FBgn0030053 | Length: | 403 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031749458.1 | Gene: | LOC100491804 / 100491804 | -ID: | - | Length: | 334 | Species: | Xenopus tropicalis |
| Alignment Length: | 205 | Identity: | 50/205 - (24%) |
|---|---|---|---|
| Similarity: | 81/205 - (39%) | Gaps: | 39/205 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 75 PFQRYGHTVVAYKDRIYIWGGRND-ENLCNTLYCFDPKTAQWS--RPQVTGCLPGARDGHSACVI 136
Fly 137 GNSMYIFGGFVDEINEFSSDVHSLNLDTMEWRYVQTFGVPPSYRDFHASVAYEQERMYIFGGRGD 201
Fly 202 KHSP------YHSQEETY---C------------HEIVYLDMKTK----VWHRPFTAG------- 234
Fly 235 KVPVGRRSHS 244 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG12081 | NP_001259343.1 | KELCH repeat | 13..69 | CDD:276965 | |
| Kelch_6 | 13..60 | CDD:290672 | |||
| KELCH repeat | 78..125 | CDD:276965 | 14/49 (29%) | ||
| Kelch_1 | 78..117 | CDD:279660 | 12/41 (29%) | ||
| KELCH repeat | 128..170 | CDD:276965 | 11/41 (27%) | ||
| Kelch_3 | 137..188 | CDD:290151 | 12/50 (24%) | ||
| KELCH repeat | 180..236 | CDD:276965 | 14/87 (16%) | ||
| Kelch_3 | 192..248 | CDD:290151 | 16/85 (19%) | ||
| Kelch_5 | 237..276 | CDD:290565 | 4/8 (50%) | ||
| LOC100491804 | XP_031749458.1 | PLN02193 | <13..>158 | CDD:177844 | 34/125 (27%) |
| KELCH repeat | 39..83 | CDD:276965 | 12/43 (28%) | ||
| KELCH repeat | 92..138 | CDD:276965 | 12/47 (26%) | ||
| KELCH repeat | 141..182 | CDD:276965 | 9/42 (21%) | ||
| Kelch_1 | 142..182 | CDD:396078 | 9/41 (22%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D933937at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.010 | |||||