DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12081 and klhdc1

DIOPT Version :9

Sequence 1:NP_001259343.1 Gene:CG12081 / 31799 FlyBaseID:FBgn0030053 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_012823418.1 Gene:klhdc1 / 100135383 XenbaseID:XB-GENE-991189 Length:394 Species:Xenopus tropicalis


Alignment Length:263 Identity:79/263 - (30%)
Similarity:122/263 - (46%) Gaps:29/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 QRYGHTVVAYKDRIYIWGG-----RNDENLCN-TLYCFDPKTAQWSRPQVTGCLPGARDGHSACV 135
            :|.||....:.:.:|:|||     .|:..|.| .::.:|..:..|......|.||.:..|.....
 Frog    13 ERSGHCAAMHDNYLYVWGGYVTIEENEVYLPNDEIWIYDIDSGLWRMHLTDGDLPPSMSGSCGAC 77

  Fly   136 IGNSMYIFGGFVDE--INE-FSSDVHSLNLDTMEWRYVQTF-GVPPSYRDFHASVAYEQERMYIF 196
            :....|:|||:.|:  .|: |..|:||.: ....|:::..| |..|:.||..:...|: :|:..|
 Frog    78 LNGKFYVFGGYDDKGYSNQLFCLDLHSKS-GQYTWKHINNFKGQSPTARDKLSCWVYD-DRLIYF 140

  Fly   197 GGRG-DKHSPYHSQEET------------YCHEIVYLDMKTKVWHRPFTAGKVPVGRRSHSMFVY 248
            ||.| .|||..:...:.            :.::|...|.||:.|.:||.....|..|.:||..:.
 Frog   141 GGYGCRKHSELNDCFDVHDASWEGQIFWGWNNDIHVFDTKTQTWFQPFVKNSPPQARAAHSCALL 205

  Fly   249 NKLIYVFGGYNGLLDQHFNDLYTFDPRTKLWN-LIRANGKAPTARRRQCAIVMG-TRMFLFGGTS 311
            :...|||||  .:|....|||:..|..|..|: .||.|||.|:.|.......:| .::|||||.|
 Frog   206 DNKGYVFGG--RVLQTRMNDLHFLDLDTWTWSGGIRINGKIPSGRSWHTLTPVGDDQLFLFGGLS 268

  Fly   312 PRS 314
            ..|
 Frog   269 EES 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12081NP_001259343.1 KELCH repeat 13..69 CDD:276965
Kelch_6 13..60 CDD:290672
KELCH repeat 78..125 CDD:276965 13/52 (25%)
Kelch_1 78..117 CDD:279660 12/44 (27%)
KELCH repeat 128..170 CDD:276965 12/44 (27%)
Kelch_3 137..188 CDD:290151 16/54 (30%)
KELCH repeat 180..236 CDD:276965 18/68 (26%)
Kelch_3 192..248 CDD:290151 19/68 (28%)
Kelch_5 237..276 CDD:290565 14/38 (37%)
klhdc1XP_012823418.1 PLN02193 <14..284 CDD:177844 79/262 (30%)
KELCH repeat 14..66 CDD:276965 13/51 (25%)
KELCH repeat 71..117 CDD:276965 12/46 (26%)
KELCH repeat 197..245 CDD:276965 20/49 (41%)
KELCH repeat 248..294 CDD:276965 9/24 (38%)
muta_rot_YjhT 258..>322 CDD:274641 7/14 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933937at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.