| Sequence 1: | NP_001259343.1 | Gene: | CG12081 / 31799 | FlyBaseID: | FBgn0030053 | Length: | 403 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001083015.1 | Gene: | zgc:163014 / 100038766 | ZFINID: | ZDB-GENE-070424-100 | Length: | 411 | Species: | Danio rerio |
| Alignment Length: | 196 | Identity: | 61/196 - (31%) |
|---|---|---|---|
| Similarity: | 94/196 - (47%) | Gaps: | 26/196 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 11 PQRVNHAAV--GVGDFIYSFGGYCTGYDYRYNEPIDVHALNAHTMRWTLVPQQLDDAGVPLKYPL 73
Fly 74 VPFQRYGHTVVAYKDRIYIWGGRN-----DENLC-NTLYCFDPKTAQWSRPQVTGCLPGARDGHS 132
Fly 133 ACVIGNSMYIFGGFVDEINEFSSDVHSLNLDTMEWRYVQTFGVPPSYRDFHASVAYEQERMYIFG 197
Fly 198 G 198 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG12081 | NP_001259343.1 | KELCH repeat | 13..69 | CDD:276965 | 14/57 (25%) |
| Kelch_6 | 13..60 | CDD:290672 | 13/48 (27%) | ||
| KELCH repeat | 78..125 | CDD:276965 | 16/52 (31%) | ||
| Kelch_1 | 78..117 | CDD:279660 | 13/44 (30%) | ||
| KELCH repeat | 128..170 | CDD:276965 | 16/41 (39%) | ||
| Kelch_3 | 137..188 | CDD:290151 | 19/50 (38%) | ||
| KELCH repeat | 180..236 | CDD:276965 | 8/19 (42%) | ||
| Kelch_3 | 192..248 | CDD:290151 | 4/7 (57%) | ||
| Kelch_5 | 237..276 | CDD:290565 | |||
| zgc:163014 | NP_001083015.1 | KELCH repeat | 89..144 | CDD:276965 | 1/1 (100%) |
| Kelch_3 | 158..203 | CDD:290151 | 15/60 (25%) | ||
| KELCH repeat | 196..247 | CDD:276965 | 16/54 (30%) | ||
| Kelch_3 | 204..259 | CDD:290151 | 19/54 (35%) | ||
| Kelch_5 | 248..283 | CDD:290565 | 14/36 (39%) | ||
| KELCH repeat | 251..297 | CDD:276965 | 17/47 (36%) | ||
| Kelch_4 | 300..342 | CDD:290154 | 8/20 (40%) | ||
| KELCH repeat | 301..342 | CDD:276965 | 8/19 (42%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D933937at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0001118 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.920 | |||||