DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG12065 and UPP1

DIOPT Version :9

Sequence 1:	NP_001368976.1	Gene:	CG12065 / 31798	FlyBaseID:	FBgn0030052	Length:	706	Species:	Drosophila melanogaster
Sequence 2:	NP_001274355.1	Gene:	UPP1 / 7378	HGNCID:	12576	Length:	310	Species:	Homo sapiens

Alignment Length:	118	Identity:	25/118 - (21%)
Similarity:	46/118 - (38%)	Gaps:	36/118 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly   622 GRDLVRSDELRTQFARKYGLLATDVEMSSVLDSIIGN--CRESFILVKGIAD------------- 671
            |:.::|..:|..:..::  ||....|:|. ..:::||  |...|...:|..|
Human   173 GKRVIRKTDLNKKLVQE--LLLCSAELSE-FTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQA 234

  Fly   672 -----YKDGTSTRKWQN--FAAI-SAASVVKSVIC----------GMDAPTNV 706
                 |..|....:.::  |||: ||..:..:|:|          .:.:|.||
Human   235 YLEAAYAAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNV 287

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG12065	NP_001368976.1	NP-I	376..696	CDD:365790	20/96 (21%)
UPP1	NP_001274355.1	UP_hUPP-like	31..305	CDD:350163	25/118 (21%)
		Phosphate binding. /evidence=ECO:0000269\|PubMed:19291308, ECO:0007744\|PDB:3EUF	138..141
		Uridine binding. /evidence=ECO:0000305\|PubMed:20856879, ECO:0007744\|PDB:3EUF, ECO:0007744\|PDB:3NBQ	142..143
		Uridine binding. /evidence=ECO:0000305\|PubMed:19291308, ECO:0000305\|PubMed:20856879, ECO:0007744\|PDB:3EUF, ECO:0007744\|PDB:3NBQ	217..219		0/1 (0%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165152628
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.930