DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12065 and upp1

DIOPT Version :9

Sequence 1:NP_001368976.1 Gene:CG12065 / 31798 FlyBaseID:FBgn0030052 Length:706 Species:Drosophila melanogaster
Sequence 2:XP_017206833.1 Gene:upp1 / 503707 ZFINID:ZDB-GENE-050306-2 Length:317 Species:Danio rerio


Alignment Length:254 Identity:55/254 - (21%)
Similarity:94/254 - (37%) Gaps:62/254 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   459 GNTTTRLLGTFQKVDYVFIVGVAGGVPHYTDYKKHVRLGDVVISYVDKQRALISNSKEKPYV--- 520
            |.:|..|...|..|.:|.:.|....:..:|:             |:.|:..|:..:.|.|.:   
Zfish    44 GTSTHDLPKMFGDVKFVCVGGSPWRMKSFTE-------------YIAKELGLVDPNAEYPNICAG 95

  Fly   521 ----YLYKSGEDVKTYFPVNDSLQQIAESLQANMQVKRPWEDYLNQAQQALAQKTDADFNRPDAR 581
                .:||.|    ....|:..:...:.|:..:..:|..:.                      ||
Zfish    96 TDRYAMYKVG----PVLSVSHGMGIPSISIMLHELIKLLYH----------------------AR 134

  Fly   582 -TDKLFMNIGNNEVIEVAHP----IAADEVDGVNRLRLHLGPIGSGRDLVRSDELRTQFARKYGL 641
             ||...:.||.:..|.: .|    :....||.:  .:.||.....|:.:|||.||..:.|.:  |
Zfish   135 CTDVTVVRIGTSGGIGL-KPGTVVVTKQSVDSL--FQPHLEQTILGKPVVRSTELDKELAEE--L 194

  Fly   642 LATDVEMSSVLDSIIGNCRESFILVKGIADYKDGT----STRKWQNFAAISAASVVKSV 696
            |....|:.. .:.||||...:....:|.|.. ||.    |....||:.|.:.|:.|:::
Zfish   195 LQCGKELGE-FEIIIGNTMCTLDFYEGQARL-DGAFCSYSEEDKQNYLAEAYAAGVRNI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12065NP_001368976.1 NP-I 376..696 CDD:365790 55/252 (22%)
upp1XP_017206833.1 PNP_UDP_1 27..311 CDD:294213 55/254 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587105
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.