DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12065 and upp2

DIOPT Version :9

Sequence 1:NP_001368976.1 Gene:CG12065 / 31798 FlyBaseID:FBgn0030052 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_956438.1 Gene:upp2 / 393113 ZFINID:ZDB-GENE-040426-830 Length:313 Species:Danio rerio


Alignment Length:229 Identity:42/229 - (18%)
Similarity:77/229 - (33%) Gaps:77/229 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   510 LISNSKEKPYVYLYKS-----------GEDVKTYFPVNDSLQQIAESLQANMQVK---------- 553
            ||:|:..|...|:.::           .||:..:|.::.....:.:...   .||          
Zfish     5 LINNTGNKHNNYIRQAKYVNNPHLDGMEEDILYHFSLSTKTHDLPQMFG---DVKFVCVGGSPNR 66

  Fly   554 -RPWEDYLNQAQQALAQKTDADFNRPDARTDKLFM-NIGNNEVIEVAHPIAADEVD--------- 607
             |.:.:|::: |..:...| ||.......||:..| .:|  .|:.::|.:....:.         
Zfish    67 MRTFAEYIHE-QLEMPSNT-ADIKDICEGTDRYSMYKVG--PVLSISHGVGVPSISIMLHELIKL 127

  Fly   608 -------GVNRLRLHL-GPIG-------------------------SGRDLVRSDELRTQFARKY 639
                   ||...|:.. |.||                         .|:.:.||.||....|:: 
Zfish   128 LYHARCRGVIIFRIGTSGGIGLAAGTIVITDKAVDSFFRPQFEQVVLGKVITRSTELDVDIAQE- 191

  Fly   640 GLLATDVEMSSVLDSIIGN--CRESFILVKGIAD 671
             ||....|::. :.::..|  |...|...:|..|
Zfish   192 -LLQYSSELTD-MPTVFANTMCTHDFYEGQGRLD 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12065NP_001368976.1 NP-I 376..696 CDD:365790 42/229 (18%)
upp2NP_956438.1 PNP_UDP_1 25..310 CDD:294213 37/209 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587109
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.