DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12065 and CG3788

DIOPT Version :9

Sequence 1:NP_001368976.1 Gene:CG12065 / 31798 FlyBaseID:FBgn0030052 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_001188991.1 Gene:CG3788 / 37644 FlyBaseID:FBgn0034800 Length:378 Species:Drosophila melanogaster


Alignment Length:119 Identity:24/119 - (20%)
Similarity:44/119 - (36%) Gaps:25/119 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 GFIKKIMKLLQHGYSEIQSIEIELRILEETSAPPSRPPRDGYIIYCYGDCNRKFEEALMAQRKTG 264
            |.:..:.::|.||.|...:.:::..:.:|             |..|:..|..|:|..:       
  Fly   196 GRLNPVHEILVHGVSVQHASQLDESLADE-------------IKMCHDPCKDKYEAVI------- 240

  Fly   265 DGDNLMKAIWLDMYTEQLISLEESQFESPPLTQEKVLELIEQAYPNPVSPEDLA 318
             |..|...   |.|..| ..|:.:..|..|..::..||.::......:..|.||
  Fly   241 -GRTLCAH---DFYEGQ-SRLDGAFCEYTPEMKKSYLETLQSQQVKNIEMESLA 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12065NP_001368976.1 NP-I 376..696 CDD:365790
CG3788NP_001188991.1 euk_UDPppase 57..345 CDD:130780 24/119 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457274
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.