DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12065 and CG17224

DIOPT Version :9

Sequence 1:NP_001368976.1 Gene:CG12065 / 31798 FlyBaseID:FBgn0030052 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_001162855.1 Gene:CG17224 / 33510 FlyBaseID:FBgn0031489 Length:300 Species:Drosophila melanogaster


Alignment Length:299 Identity:60/299 - (20%)
Similarity:96/299 - (32%) Gaps:101/299 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 DPNLTNSLRKSKKKRRFGESNVYTLGNIGAHR-----------IVSTKLPSVG----SNREAMTA 457
            |.|:.|:...|:.:.|||:..|..:|..|:..           :||.....|.    .||.||..
  Fly    25 DINVANTRDTSELQNRFGDVRVICMGGTGSRMRQLALYLRDILVVSESGDPVDLCERGNRYAMYK 89

  Fly   458 TG------------------NTTTRLLGTFQKVDYVFI-VGVAG--GVPHYTDYKKHVRLGDVVI 501
            .|                  :...:||...:..|.|.: :|..|  |||..|           |:
  Fly    90 VGPVLCVSHGVGSSSFSVVLHELIKLLKYARCQDPVLLRIGTCGGLGVPPGT-----------VV 143

  Fly   502 SYVDKQRALISNSKE---------KPYVYLYKSGEDVKTYFPVNDSLQQIAESLQANMQVKRPWE 557
            :..:....|:.|..|         :|..:    .|||     :.|.|   |..:.||       :
  Fly   144 ASKNAFNGLLRNEHEIAILGQRVVRPAQF----SEDV-----IRDLL---AFGVDAN-------D 189

  Fly   558 DYLNQAQQALAQKTDADFNRPDARTDKLFMNIGNN---EVIEVAHPIAADEVDGVNRLRLHLGPI 619
            .:  |...|....||. |.....|||.........   |.::..|.:      |:..:.:.....
  Fly   190 GF--QTISANTMGTDC-FYEGQGRTDGAICEYSEKDKMEFLQKCHDL------GIRNIEMEASMF 245

  Fly   620 GSGRDLVRSDELRTQFARKYGLLATDVEMSSVLDSIIGN 658
            .|             ..:|.|:.|.|| ..:::|.:.|:
  Fly   246 AS-------------VTQKVGVKAGDV-CVTLIDRLKGD 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12065NP_001368976.1 NP-I 376..696 CDD:365790 60/299 (20%)
CG17224NP_001162855.1 euk_UDPppase 10..300 CDD:130780 60/299 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457275
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.