DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12065 and Upp1

DIOPT Version :9

Sequence 1:NP_001368976.1 Gene:CG12065 / 31798 FlyBaseID:FBgn0030052 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_001025196.1 Gene:Upp1 / 289801 RGDID:1305566 Length:312 Species:Rattus norvegicus


Alignment Length:193 Identity:41/193 - (21%)
Similarity:69/193 - (35%) Gaps:50/193 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IGTGTGNGTLPNGNKNYNKIVAVQDQEPLAQNSSGVQRSQSPPRTEQVVMTPRGKTANSTVILIE 100
            |||..|.|..|.     :.::..|..:...:           |..||:|:..| .|.|::   ::
  Rat   141 IGTSGGIGLEPG-----SVVITQQAVDECFK-----------PEFEQIVLGKR-VTRNTS---LD 185

  Fly   101 RKLVDE-------INDRVHVAG------------GDHTGIIIN---KDTVAGQKSASKAAALSLE 143
            .:||.|       :|:...|.|            |...|.:.:   ||..|..::|..|...::|
  Rat   186 AQLVQELMQCSSDLNEFPTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLRAAHAAGVRNIE 250

  Fly   144 FRVFLVSANTGKHSQESRTLRFWFRDWLTNEE-KQAHIAQDFFKELVSPQDFPRDYVG-FIKK 204
            ....:.:........::..:.....|.|..:: ...|      ..||..|..|:..|| ||||
  Rat   251 MESSVFATMCSACGLKAAVVCVTLLDRLQGDQINTPH------NVLVEYQQRPQRLVGHFIKK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12065NP_001368976.1 NP-I 376..696 CDD:365790
Upp1NP_001025196.1 UP_hUPP-like 33..307 CDD:350163 39/191 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346149
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.