DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12065 and Upp1

DIOPT Version :9

Sequence 1:NP_001368976.1 Gene:CG12065 / 31798 FlyBaseID:FBgn0030052 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_001152873.1 Gene:Upp1 / 22271 MGIID:1097668 Length:311 Species:Mus musculus


Alignment Length:99 Identity:23/99 - (23%)
Similarity:39/99 - (39%) Gaps:24/99 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   622 GRDLVRSDELRTQFARKYGLLATDVEMSSVLDS---IIGN--CRESFILVKGIAD-------YKD 674
            |:.::|:..|..|..::.      |:.||.|:.   ::||  |...|...:|..|       .||
Mouse   174 GKRVIRNTNLDAQLVQEL------VQCSSDLNEFPMVVGNTMCTLDFYEGQGRLDGALCSYTEKD 232

  Fly   675 GTSTRKWQNFAAISAASVVKSVI------CGMDA 702
            ..|..:..:.|.:....:..||.      ||:.|
Mouse   233 KQSYLRAAHAAGVRNIEMESSVFATMCSACGLKA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12065NP_001368976.1 NP-I 376..696 CDD:365790 18/85 (21%)
Upp1NP_001152873.1 UP_hUPP-like 32..306 CDD:350163 23/99 (23%)
Phosphate binding. /evidence=ECO:0000250|UniProtKB:Q16831 139..142
Uridine binding. /evidence=ECO:0000250|UniProtKB:Q16831 143..144
Uridine binding. /evidence=ECO:0000250|UniProtKB:Q16831 218..220 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842684
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.