DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32320 and Dcstamp

DIOPT Version :9

Sequence 1:NP_001097472.3 Gene:CG32320 / 317977 FlyBaseID:FBgn0052320 Length:767 Species:Drosophila melanogaster
Sequence 2:XP_008763694.1 Gene:Dcstamp / 103690326 RGDID:1310435 Length:470 Species:Rattus norvegicus


Alignment Length:597 Identity:115/597 - (19%)
Similarity:195/597 - (32%) Gaps:210/597 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 VGLLMVLIWYYRNPQEACKDLNGKWIFIVLLSFLLIILVRRRPARCIAVLCLSSLSSNQFRIAVI 171
            |.||...: |:..|..|.  |:..|:      ...:.|...:.|||..:|.:.|....:.|..::
  Rat    44 VSLLSAAL-YWVLPSAAL--LSAVWM------ATCVFLCCSKHARCFILLAIVSCGLREGRNTLL 99

  Fly   172 ALCFLLAFSGPVKNIIHNTCILANTLTCEQNVLIQALMLMQRIINDPSHSVEEAFKTTLAEVSRL 236
            |....:...|.|:||..|...|.:::||....                    :.|.|....:.|.
  Rat   100 AAGTGVVIFGHVENIFSNFRGLLDSMTCNLRA--------------------KNFSTHFPLLKRY 144

  Fly   237 MNKLDKLLLNLERPIAQIHATFKTCTDWLFLQKDHYDYKMGSPYNRCLKAGNLSIAHCKREFGEG 301
            :..:                      :|:        |.:.:|.|                    
  Rat   145 IEAI----------------------EWI--------YGLTTPLN-------------------- 159

  Fly   302 QKECCKLELFLWFCNSLKTYTTFFDDNIQWSQMVIKDIFQRLQLCFVKIRFIFITTISFDHSLKF 366
                                  ..||.:.|:|.:...:|                  |..|:|  
  Rat   160 ----------------------VLDDLVSWNQTLAVSLF------------------SPSHAL-- 182

  Fly   367 NSTGAFSSNIDQIDEQDVKEEFEAQRHKLHFVYLWLNLIIFI---------LLLTIIYKSL---- 418
                       |....|.:.|..:   .||.:.|...|:..:         |||.::...|    
  Rat   183 -----------QAHMNDTRGEVLS---VLHRMVLTTELLTSVGQKLLALAGLLLILVSTGLFLKR 233

  Fly   419 ----CFWFRYLTDNDFENFYITEAFEDYDDQYYQIMGLRVLPLSNCEDNKFVKISSMRLLAKEFD 479
                |.|       .:||.|||..|..:|::........||||:..|..|::.:.|::|..||..
  Rat   234 FLGPCGW-------KYENVYITRQFVLFDEEERCQQRPCVLPLNRKERKKYIIVPSLKLTPKERR 291

  Fly   480 TIYRSAMFL-VITGIQL-LCICFVDYSLYSLLTLMSYHGHMIEDVKPPSYTKIVING-----GGK 537
            .:  ...|| |:|.:.: :....|||.||.|::.::.....:    |.....:.::|     .|.
  Rat   292 NL--GLFFLPVLTYLYMWMLFATVDYLLYRLISSVNKQFQSL----PGLEVHLRLHGEKQGTHGV 350

  Fly   538 IGDMLRDLVQAFEPRTFKMNTQRCLPIPGYPKYLRYVWILLLYLLAWFLVFWEPYGL------RQ 596
            |.|...: :..|||        .|:..|...  :...|:.|..:|...::.    ||      :.
  Rat   351 IHDSAFN-ISMFEP--------SCILKPRLS--VSQTWVPLSIILLTLVIL----GLLSSMLMQL 400

  Fly   597 RHRVMMYFYPEESRRRSHDLHDTILINRKHFFKARCMEA-RLLNAFESTQEFKSCATWFNSRLNW 660
            :..|.:.|||:..|.|...||..:|..|.   |....|| |.|:.:     ||        ::::
  Rat   401 KILVSVSFYPKVERERIEYLHAKLLEKRS---KQPLGEADRKLSLY-----FK--------KIHF 449

  Fly   661 YALTLYLNRFKH 672
            :...|.:.|.||
  Rat   450 WLPVLKMTRKKH 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32320NP_001097472.3 DC_STAMP 430..617 CDD:285077 48/199 (24%)
DcstampXP_008763694.1 DC_STAMP 242..421 CDD:285077 48/199 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354352
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21041
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.