DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30B and Naa11

DIOPT Version :9

Sequence 1:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001028363.1 Gene:Naa11 / 97243 MGIID:2141314 Length:218 Species:Mus musculus


Alignment Length:135 Identity:46/135 - (34%)
Similarity:65/135 - (48%) Gaps:3/135 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LSEPYSIYTYRYFVYNWPDLCFFALDGD-RYVGVIVCKLEAKRDGYLQGYIAMLAVDAEYRKRGI 137
            |.|.|.:..|.|...:||.|.:.|.|.| :.||.::.|:|...|....|:|..|||...:|:.|:
Mouse    22 LPENYQMKYYFYHGLSWPQLSYIAEDEDGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGL 86

  Fly   138 GRALSEMAIDAMAIRDAAMIV-LETELSNKPALALY-QSLGFIRERRFLRYYLNGMDAFHLKLML 200
            .:.|.:.|..||.....|..| |....||:.||.|| .:|.|.......:||.:|.||:.:|..|
Mouse    87 AQKLMDQASRAMIENFGAKYVSLHVRKSNRAALHLYSNTLNFQVSEVEPKYYADGEDAYAMKRDL 151

  Fly   201 HDFID 205
            ....|
Mouse   152 SQMTD 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30BNP_728606.1 rimI 70..194 CDD:273701 42/122 (34%)
Acetyltransf_1 99..177 CDD:278980 28/80 (35%)
Naa11NP_001028363.1 RimI 1..149 CDD:223532 43/126 (34%)
Interaction with NAA15. /evidence=ECO:0000250 1..58 13/35 (37%)
Acetyltransf_1 47..122 CDD:278980 25/74 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.