DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30B and Nat8f3

DIOPT Version :9

Sequence 1:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001032931.1 Gene:Nat8f3 / 93674 MGIID:2136449 Length:227 Species:Mus musculus


Alignment Length:203 Identity:47/203 - (23%)
Similarity:90/203 - (44%) Gaps:30/203 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KELSDKDSQEKMDL----VTKNLP-LFAEKIVLPENDTAAKSEGIHFCVF-HDESQLKVLMGLID 71
            ::....|.:..:||    :.:::| .|...::||.  |.....|:...:| ...|.|.||:.::.
Mouse     7 RKYQGSDHRSVVDLFRRGMEEHIPATFRHMLLLPR--TLLLLLGVPLTLFLASGSWLLVLLSILT 69

  Fly    72 KELSEPY-SIYTYRYFVYN-----WPDL----------CFFALDG-DRYVGVIVCKLEAKRDGYL 119
            ..||..: :.||:...|.|     ..|:          ||:..:. .:.||::..:  ..:|..|
Mouse    70 LFLSLWFLAKYTWEKHVMNCLHTDMADITRTYLSSHSSCFWVAESRGQTVGMVAAR--PVKDPLL 132

  Fly   120 QG---YIAMLAVDAEYRKRGIGRALSEMAIDAMAIRDAAMIVLETELSNKPALALYQSLGFIRER 181
            |.   .:..|:|..::|:.|:|:|:....:....::..:.:||.|.:....||||||.:||.:..
Mouse   133 QKKQLQLLHLSVSLQHRREGLGKAMVRTVLQFAQMQGFSEVVLSTSMLQYAALALYQGMGFQKTG 197

  Fly   182 RFLRYYLN 189
            .....||:
Mouse   198 ETFYTYLS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30BNP_728606.1 rimI 70..194 CDD:273701 33/140 (24%)
Acetyltransf_1 99..177 CDD:278980 20/81 (25%)
Nat8f3NP_001032931.1 Acetyltransf_7 106..195 CDD:379228 24/90 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.