DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30B and ARD1

DIOPT Version :9

Sequence 1:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_011877.1 Gene:ARD1 / 856404 SGDID:S000001055 Length:238 Species:Saccharomyces cerevisiae


Alignment Length:188 Identity:47/188 - (25%)
Similarity:72/188 - (38%) Gaps:51/188 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LSEPYSIYTYRYFVYNWPDLCFFA---------------------------------LD------ 99
            |.|.|.:..|.|.:.:||:..|.|                                 ||      
Yeast    24 LPENYMMKYYMYHILSWPEASFVATTTTLDCEDSDEQDENDKLELTLDGTNDGRTIKLDPTYLAP 88

  Fly   100 GDRYVGVIVCKLEAKRDGYLQ---GYIAMLAVDAEYRKRGIGRALSEMAIDAM-AIRDAAMIVLE 160
            |::.||.::.|:....|...:   |:|..|:|...||:.||...|...|:.|: .:..|..:.|.
Yeast    89 GEKLVGYVLVKMNDDPDQQNEPPNGHITSLSVMRTYRRMGIAENLMRQALFALREVHQAEYVSLH 153

  Fly   161 TELSNKPALALYQ-SLGFIRERRFLRYYLNGMDAFHLK-------LMLHDFIDSSLNE 210
            ...||:.||.||: :|.|........||.:|.||:.:|       |.:.:|....|.|
Yeast   154 VRQSNRAALHLYRDTLAFEVLSIEKSYYQDGEDAYAMKKVLKLEELQISNFTHRRLKE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30BNP_728606.1 rimI 70..194 CDD:273701 41/163 (25%)
Acetyltransf_1 99..177 CDD:278980 26/88 (30%)
ARD1NP_011877.1 RimI 1..192 CDD:223532 42/167 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.