DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30B and MAK3

DIOPT Version :9

Sequence 1:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_015376.1 Gene:MAK3 / 856163 SGDID:S000006255 Length:176 Species:Saccharomyces cerevisiae


Alignment Length:147 Identity:72/147 - (48%)
Similarity:94/147 - (63%) Gaps:5/147 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 DESQLKVLMGLIDKELSEPYSIYTYRYFVYNWPDLCFFALDG-----DRYVGVIVCKLEAKRDGY 118
            :|.|...:..|||.:||||||||.||||:..||:|.:.|:|.     :..:|.||||::..|:..
Yeast    12 NEEQFASIKKLIDADLSEPYSIYVYRYFLNQWPELTYIAVDNKSGTPNIPIGCIVCKMDPHRNVR 76

  Fly   119 LQGYIAMLAVDAEYRKRGIGRALSEMAIDAMAIRDAAMIVLETELSNKPALALYQSLGFIRERRF 183
            |:|||.||||::.||..||.:.|.|:|||.|.......|:||||:.|..||.||:.:||||.:|.
Yeast    77 LRGYIGMLAVESTYRGHGIAKKLVEIAIDKMQREHCDEIMLETEVENSAALNLYEGMGFIRMKRM 141

  Fly   184 LRYYLNGMDAFHLKLML 200
            .|||||..|||.|.|.|
Yeast   142 FRYYLNEGDAFKLILPL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30BNP_728606.1 rimI 70..194 CDD:273701 64/128 (50%)
Acetyltransf_1 99..177 CDD:278980 35/82 (43%)
MAK3NP_015376.1 RimI 26..162 CDD:223532 67/133 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345761
Domainoid 1 1.000 96 1.000 Domainoid score I1639
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I1218
Isobase 1 0.950 - 0 Normalized mean entropy S678
OMA 1 1.010 - - QHG54255
OrthoFinder 1 1.000 - - FOG0002360
OrthoInspector 1 1.000 - - otm46581
orthoMCL 1 0.900 - - OOG6_101962
Panther 1 1.100 - - O PTHR45896
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3472
SonicParanoid 1 1.000 - - X2923
TreeFam 1 0.960 - -
1514.740

Return to query results.
Submit another query.