DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30B and kat14

DIOPT Version :9

Sequence 1:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001072678.1 Gene:kat14 / 780135 XenbaseID:XB-GENE-947246 Length:776 Species:Xenopus tropicalis


Alignment Length:221 Identity:55/221 - (24%)
Similarity:81/221 - (36%) Gaps:61/221 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DKDSQ---------------EKMDLVTKNL--PLFAEKIVLP---ENDTAAKSEG-IHFCVFHDE 60
            ||||.               .:.|..||.|  .|.||....|   |.|...:.|. |.:| :...
 Frog   576 DKDSDLSIVSPYTARVLKPYIRRDYETKTLKQQLLAEIKAFPHRNEPDWQPEPESPIDYC-YVRP 639

  Fly    61 SQLKVLMGLIDK------ELSEPYSIYTYRYFVYNWPDLCFFALDGDRYVGVIVC----KLEAKR 115
            |.:..:..:..:      :|||          ...:||....||    |..|:|.    ..:.| 
 Frog   640 SHIPTINSICQEFFWPGIDLSE----------CLQYPDFSVVAL----YKKVVVAFGFMVPDVK- 689

  Fly   116 DGYLQGYIAMLAVDAEYRKRGIGRALSEMAIDAMAIRDAAMIVLETELSNKPALALYQSLGFIRE 180
              |.:.||:.|.|..|:|:.||...:....|.....:|..:.|    .:|..|:.|||..||..:
 Frog   690 --YNEAYISFLFVHPEWRRAGIATFMIYHLIQTCMGKDVTLHV----SANSSAMLLYQKFGFKTQ 748

  Fly   181 RRFLRYY-----LNGMD---AFHLKL 198
            ...|.:|     |:..:   ||.|:|
 Frog   749 EYILDFYDKYYPLDSKECKHAFFLRL 774

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30BNP_728606.1 rimI 70..194 CDD:273701 33/141 (23%)
Acetyltransf_1 99..177 CDD:278980 21/81 (26%)
kat14NP_001072678.1 Acetyltransf_1 <666..745 CDD:366181 25/89 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.