DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30B and Naa30

DIOPT Version :9

Sequence 1:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_006519605.1 Gene:Naa30 / 70646 MGIID:1922259 Length:375 Species:Mus musculus


Alignment Length:197 Identity:91/197 - (46%)
Similarity:127/197 - (64%) Gaps:15/197 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ELSDKDSQEKMDLVTKNLPLFAEKIVLPENDTAAKSEG----------IHFCVFHDESQLKVLMG 68
            |.:::..:|:||   :.:.|.:..  |....:...|:|          |.:..:..|.|:..:|.
Mouse   183 EGTEQQEEEEMD---EQVRLLSSS--LTTGCSLRSSQGREAEPGEDRTIRYVRYESELQMPDIMR 242

  Fly    69 LIDKELSEPYSIYTYRYFVYNWPDLCFFALDGDRYVGVIVCKLEAKRDGYLQGYIAMLAVDAEYR 133
            ||.|:|||||||||||||::|||.|||.|:.|:..||.|||||:..:..:.:|||||||||::||
Mouse   243 LITKDLSEPYSIYTYRYFIHNWPQLCFLAMVGEECVGAIVCKLDMHKKMFRRGYIAMLAVDSKYR 307

  Fly   134 KRGIGRALSEMAIDAMAIRDAAMIVLETELSNKPALALYQSLGFIRERRFLRYYLNGMDAFHLKL 198
            :.|||..|.:.||.||...|...:|||||::||.||.||::|||:|::|..||||||:||..|||
Mouse   308 RNGIGTNLVKKAIYAMVEGDCDEVVLETEITNKSALKLYENLGFVRDKRLFRYYLNGVDALRLKL 372

  Fly   199 ML 200
            .|
Mouse   373 WL 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30BNP_728606.1 rimI 70..194 CDD:273701 73/123 (59%)
Acetyltransf_1 99..177 CDD:278980 40/77 (52%)
Naa30XP_006519605.1 RimI 222..375 CDD:223532 83/153 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847990
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S678
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002360
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101962
Panther 1 1.100 - - O PTHR45896
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3472
SonicParanoid 1 1.000 - - X2923
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.680

Return to query results.
Submit another query.