DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30B and Nat8f1

DIOPT Version :9

Sequence 1:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_038964231.1 Gene:Nat8f1 / 59300 RGDID:621606 Length:255 Species:Rattus norvegicus


Alignment Length:207 Identity:47/207 - (22%)
Similarity:81/207 - (39%) Gaps:42/207 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KELSDKDSQEKMDLVTKNL-----PLFAEKIVLPENDTAAKSEGIHF--------------CVFH 58
            ::..|.|.:..:|:.||.:     ..|...::||.  |.....|:..              |:|.
  Rat    17 RQYQDSDHKSVVDVFTKGMEEHIPSTFRHMLMLPR--TLLLLLGVPLALVLVSGSWLLAVVCIFF 79

  Fly    59 DESQLKVLMGLIDKELSEPYSIYTYRYFVYNWPDLC----------FFALDGDRYVGVIVCKLEA 113
            ....|:.|.|       :|:..|.......:..|:.          :.|..|::.|| ||..|..
  Rat    80 LLLLLRFLAG-------QPWKEYVATCLRTDMADITKSYLNAHGSFWVAESGNQVVG-IVAALPV 136

  Fly   114 K--RDGYLQGYIAMLAVDAEYRKRGIGRALSEMAIDAMAIRDAAMIVLETELSNKPALALYQSLG 176
            |  ..|..|..:..|:|.:::|.:||.:||....:.....:....:||||....:.|:.||..:|
  Rat   137 KDPPSGRKQLQLFRLSVSSQHRGQGIAKALVRTVLQFARDQGYTDVVLETSTLQQGAMTLYLGMG 201

  Fly   177 FIRE-RRFLRYY 187
            |.:. :|||..:
  Rat   202 FQKTGQRFLTMF 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30BNP_728606.1 rimI 70..194 CDD:273701 32/131 (24%)
Acetyltransf_1 99..177 CDD:278980 23/79 (29%)
Nat8f1XP_038964231.1 Acetyltransf_1 92..202 CDD:395465 26/110 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.