DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Naa30B and KAT14

DIOPT Version :9

Sequence 1:	NP_728606.1	Gene:	Naa30B / 317976	FlyBaseID:	FBgn0052319	Length:	211	Species:	Drosophila melanogaster
Sequence 2:	NP_001371121.2	Gene:	KAT14 / 57325	HGNCID:	15904	Length:	782	Species:	Homo sapiens

Alignment Length:	89	Identity:	29/89 - (32%)
Similarity:	40/89 - (44%)	Gaps:	12/89 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly   118 YLQGYIAMLAVDAEYRKRGIGRALSEMAIDAMAIRDAAMIVLETELSNKPALALYQSLGFIRERR 182
            |.:.||:.|.|..|:|:.||...:....|.....:|   :.|....|| ||:.|||..||..|..
Human   696 YNEAYISFLFVHPEWRRAGIATFMIYHLIQTCMGKD---VTLHVSASN-PAMLLYQKFGFKTEEY 756

  Fly   183 FLRYY-----LNGMD---AFHLKL 198
            .|.:|     |...:   ||.|:|
Human   757 VLDFYDKYYPLESTECKHAFFLRL 780

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Naa30B	NP_728606.1	rimI	70..194	CDD:273701	25/83 (30%)
Naa30B	NP_728606.1	Acetyltransf_1	99..177	CDD:278980	19/58 (33%)
KAT14	NP_001371121.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	13..33
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	251..282
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	315..346
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	400..460
		Acetyltransf_1	<672..751	CDD:395465	19/58 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0456
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900