DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30B and nat15

DIOPT Version :9

Sequence 1:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001076341.1 Gene:nat15 / 570640 ZFINID:ZDB-GENE-041111-143 Length:242 Species:Danio rerio


Alignment Length:198 Identity:48/198 - (24%)
Similarity:78/198 - (39%) Gaps:54/198 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 VLPENDTAAKSEGIHFCVFHDE-SQLKVLMGLIDKELSEPYSIYTYRYFVYNWPDLCFFALDGDR 102
            |:|   |.|.||.....:.||: .::|||.|               .:|...:||..:..:..::
Zfish     4 VVP---TTALSEIQLRLLCHDDIDRIKVLCG---------------EWFPIEYPDSWYHDITSNK 50

  Fly   103 ------------YVGVIVCKLEA-----KRDGYL----------QGYIAMLAVDAEYRKRGIGRA 140
                        .||:||.::::     |.||.:          ..||..|.|..|:||.|||..
Zfish    51 KFFSLAATFRGGIVGMIVAEIKSRTKVHKEDGDILASSFPVDTQVAYILSLGVVKEFRKHGIGSL 115

  Fly   141 LSEMA---IDAMAIRDAAMIVLETELSNKPALALYQSLGFIRERRFLRYY--LNGM--DAFHLKL 198
            |.:..   |...|......|.|....:|..|:..|::..| ::..:|.||  :.|:  |.|...|
Zfish   116 LLDSLKEHISTTAQDHCKAIYLHVLTTNNTAIHFYENRDF-KQHHYLPYYYSIRGVLKDGFTYVL 179

  Fly   199 MLH 201
            .::
Zfish   180 YIN 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30BNP_728606.1 rimI 70..194 CDD:273701 34/157 (22%)
Acetyltransf_1 99..177 CDD:278980 25/107 (23%)
nat15NP_001076341.1 RimI 20..166 CDD:223532 38/161 (24%)
Acetyltransf_1 79..156 CDD:278980 22/77 (29%)
Acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:Q9H7X0 101..103 1/1 (100%)
Acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:Q9H7X0 109..114 3/4 (75%)
Acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:Q9H7X0 150..153 1/2 (50%)
Required for homodimerization. /evidence=ECO:0000250|UniProtKB:Q9H7X0 162..173 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.