Sequence 1: | NP_728606.1 | Gene: | Naa30B / 317976 | FlyBaseID: | FBgn0052319 | Length: | 211 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001076341.1 | Gene: | nat15 / 570640 | ZFINID: | ZDB-GENE-041111-143 | Length: | 242 | Species: | Danio rerio |
Alignment Length: | 198 | Identity: | 48/198 - (24%) |
---|---|---|---|
Similarity: | 78/198 - (39%) | Gaps: | 54/198 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 VLPENDTAAKSEGIHFCVFHDE-SQLKVLMGLIDKELSEPYSIYTYRYFVYNWPDLCFFALDGDR 102
Fly 103 ------------YVGVIVCKLEA-----KRDGYL----------QGYIAMLAVDAEYRKRGIGRA 140
Fly 141 LSEMA---IDAMAIRDAAMIVLETELSNKPALALYQSLGFIRERRFLRYY--LNGM--DAFHLKL 198
Fly 199 MLH 201 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Naa30B | NP_728606.1 | rimI | 70..194 | CDD:273701 | 34/157 (22%) |
Acetyltransf_1 | 99..177 | CDD:278980 | 25/107 (23%) | ||
nat15 | NP_001076341.1 | RimI | 20..166 | CDD:223532 | 38/161 (24%) |
Acetyltransf_1 | 79..156 | CDD:278980 | 22/77 (29%) | ||
Acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:Q9H7X0 | 101..103 | 1/1 (100%) | |||
Acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:Q9H7X0 | 109..114 | 3/4 (75%) | |||
Acetyl-CoA binding. /evidence=ECO:0000250|UniProtKB:Q9H7X0 | 150..153 | 1/2 (50%) | |||
Required for homodimerization. /evidence=ECO:0000250|UniProtKB:Q9H7X0 | 162..173 | 3/10 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0456 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |