DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30B and kat14

DIOPT Version :9

Sequence 1:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001002699.2 Gene:kat14 / 562636 ZFINID:ZDB-GENE-040718-452 Length:782 Species:Danio rerio


Alignment Length:70 Identity:23/70 - (32%)
Similarity:32/70 - (45%) Gaps:4/70 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 YLQGYIAMLAVDAEYRKRGIGRALSEMAIDAMAIRDAAMIVLETELSNKPALALYQSLGFIRERR 182
            |.:.||:.|.|..|:|:.||...:....|.....:|   :.|....||. |:.|||..||..|..
Zfish   696 YNEAYISFLLVHPEWRRAGIATFMIYHLIQTCMGKD---VTLHVSASNS-AMLLYQKFGFKTEEY 756

  Fly   183 FLRYY 187
            .|.:|
Zfish   757 ILDFY 761

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30BNP_728606.1 rimI 70..194 CDD:273701 23/70 (33%)
Acetyltransf_1 99..177 CDD:278980 18/58 (31%)
kat14NP_001002699.2 PHD_SF 65..110 CDD:304600
RimI <670..763 CDD:223532 23/70 (33%)
Acetyltransf_1 683..752 CDD:278980 19/59 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.