DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30B and NAA20

DIOPT Version :9

Sequence 1:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_057184.1 Gene:NAA20 / 51126 HGNCID:15908 Length:178 Species:Homo sapiens


Alignment Length:135 Identity:37/135 - (27%)
Similarity:66/135 - (48%) Gaps:9/135 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LSEPYSIYTYRYFVYNWPDLCFFA-LDGDRYVGVIVCKLEAK--RDGYLQGYIAMLAVDAEYRKR 135
            |:|.|.|..|..::.:||:....| ..|...:|.|:.|.|..  |:.: .|::..|:|..|:|:.
Human    23 LTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEW-HGHVTALSVAPEFRRL 86

  Fly   136 GIGRALSEMAIDAMAIRDAAMIVLETELSNKPALALYQSLGFIRERRFLRYY--LNG---MDAFH 195
            |:...|.|:..:....:....:.|...:||:.|:.:|:.||:...|..:.||  .||   .||:.
Human    87 GLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYD 151

  Fly   196 LKLML 200
            ::..|
Human   152 MRKAL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30BNP_728606.1 rimI 70..194 CDD:273701 35/127 (28%)
Acetyltransf_1 99..177 CDD:278980 20/79 (25%)
NAA20NP_057184.1 RimI 1..156 CDD:223532 36/133 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.