DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30B and Naa30

DIOPT Version :9

Sequence 1:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001102569.1 Gene:Naa30 / 498489 RGDID:1559923 Length:362 Species:Rattus norvegicus


Alignment Length:192 Identity:88/192 - (45%)
Similarity:125/192 - (65%) Gaps:1/192 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LIQKELSDKDSQEKMDLVTKNLPLFAE-KIVLPENDTAAKSEGIHFCVFHDESQLKVLMGLIDKE 73
            |::....:::..|::.|::.:|..... ...|.......:...|.:..:..|.|:..:|.||.|:
  Rat   170 LVEGNEQEEEEDEQVRLLSSSLTTGCSLSSSLGREAEPGEDRTIRYVRYESELQMPDIMRLITKD 234

  Fly    74 LSEPYSIYTYRYFVYNWPDLCFFALDGDRYVGVIVCKLEAKRDGYLQGYIAMLAVDAEYRKRGIG 138
            |||||||||||||::|||.|||.|:.|:..||.|||||:..:..:.:|||||||||::||:.|||
  Rat   235 LSEPYSIYTYRYFIHNWPQLCFLAMVGEECVGAIVCKLDMHKKMFRRGYIAMLAVDSKYRRNGIG 299

  Fly   139 RALSEMAIDAMAIRDAAMIVLETELSNKPALALYQSLGFIRERRFLRYYLNGMDAFHLKLML 200
            ..|.:.||.||...|...:|||||::||.||.||::|||:|::|..||||||:||..|||.|
  Rat   300 TNLVKKAIYAMVEGDCDEVVLETEITNKSALKLYENLGFVRDKRLFRYYLNGVDALRLKLWL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30BNP_728606.1 rimI 70..194 CDD:273701 73/123 (59%)
Acetyltransf_1 99..177 CDD:278980 40/77 (52%)
Naa30NP_001102569.1 RimI 209..362 CDD:223532 83/153 (54%)
Acetyltransf_1 <281..339 CDD:278980 33/57 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351569
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 173 1.000 Inparanoid score I3994
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1323575at2759
OrthoFinder 1 1.000 - - FOG0002360
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101962
Panther 1 1.100 - - O PTHR45896
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2923
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.760

Return to query results.
Submit another query.