DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30B and naa50

DIOPT Version :9

Sequence 1:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_031751771.1 Gene:naa50 / 496547 XenbaseID:XB-GENE-996002 Length:170 Species:Xenopus tropicalis


Alignment Length:124 Identity:33/124 - (26%)
Similarity:58/124 - (46%) Gaps:12/124 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 HDESQLKVLMGLIDKELSEPYSIYTYRYF--VYNWPDLCFFALDGDRYVGVIVCKLEAKRDGYLQ 120
            |:..|||.|     .::..|.| |..:::  |....:|...|...|..||.:.|:::..:: ..:
 Frog    14 HNIKQLKRL-----NQVIFPVS-YNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQN-QKR 71

  Fly   121 GYIAMLAVDAEYRKRGIGRALSEMAIDAMAIRDAAM--IVLETELSNKPALALYQSLGF 177
            .||..|...|.||:.|||..:....:: :..:|...  |.|..::||:.|:..|:..||
 Frog    72 LYIMTLGCLAPYRRLGIGTKMLNHVLN-ICEKDGTFDNIYLHVQISNESAIDFYRKFGF 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30BNP_728606.1 rimI 70..194 CDD:273701 28/112 (25%)
Acetyltransf_1 99..177 CDD:278980 20/79 (25%)
naa50XP_031751771.1 RimI 10..145 CDD:223532 33/124 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.