DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30B and san

DIOPT Version :9

Sequence 1:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_524779.1 Gene:san / 44724 FlyBaseID:FBgn0024188 Length:184 Species:Drosophila melanogaster


Alignment Length:124 Identity:33/124 - (26%)
Similarity:57/124 - (45%) Gaps:12/124 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 HDESQLKVLMGLIDKELSEPYSIYTYRYF--VYNWPDLCFFALDGDRYVGVIVCKLEAKRDGYLQ 120
            |:..|||.|..::     .|.| |..:::  |....:|...|...|..||.:.|::: ..:...:
  Fly    14 HNIKQLKKLNTVV-----FPVS-YNDKFYVDVLEAGELAKLAYYNDIVVGAVCCRID-NTENQRR 71

  Fly   121 GYIAMLAVDAEYRKRGIGRALSEMAIDAMAIRDAAM--IVLETELSNKPALALYQSLGF 177
            .||..|...:.||:.|||..:.|..:: .|.:|...  |.|..:::|..|:..|:..||
  Fly    72 LYIMTLGCLSPYRRLGIGTVMFEHIMN-FAEKDGNFDSIFLHVQINNNGAIEFYKKFGF 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30BNP_728606.1 rimI 70..194 CDD:273701 28/112 (25%)
Acetyltransf_1 99..177 CDD:278980 20/79 (25%)
sanNP_524779.1 RimI <27..145 CDD:223532 28/106 (26%)
Acetyltransf_1 50..130 CDD:278980 22/82 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466534
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.