Sequence 1: | NP_728606.1 | Gene: | Naa30B / 317976 | FlyBaseID: | FBgn0052319 | Length: | 211 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_996032.1 | Gene: | Naa60 / 39142 | FlyBaseID: | FBgn0036039 | Length: | 276 | Species: | Drosophila melanogaster |
Alignment Length: | 205 | Identity: | 48/205 - (23%) |
---|---|---|---|
Similarity: | 76/205 - (37%) | Gaps: | 61/205 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 TAAKSEGIHFCVFHDESQLKVLMGLIDKELSEPYSIYTYRYFVYNWP-----DLC----FFALDG 100
Fly 101 D---RYVGVIVCKLEAKRD---------------------------GYLQ---------GYIAML 126
Fly 127 AVDAEYRKRGIGRALSEMAIDAMAIRD---AAMIVLETELSNKPALALYQSLGFIRERRFLRYYL 188
Fly 189 N----GMDAF 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Naa30B | NP_728606.1 | rimI | 70..194 | CDD:273701 | 40/178 (22%) |
Acetyltransf_1 | 99..177 | CDD:278980 | 23/119 (19%) | ||
Naa60 | NP_996032.1 | RimI | 74..207 | CDD:223532 | 30/133 (23%) |
Acetyltransf_1 | <136..198 | CDD:278980 | 17/61 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0456 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |