DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30B and Naa60

DIOPT Version :9

Sequence 1:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_996032.1 Gene:Naa60 / 39142 FlyBaseID:FBgn0036039 Length:276 Species:Drosophila melanogaster


Alignment Length:205 Identity:48/205 - (23%)
Similarity:76/205 - (37%) Gaps:61/205 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TAAKSEGIHFCVFHDESQLKVLMGLIDKELSEPYSIYTYRYFVYNWP-----DLC----FFALDG 100
            |....|.:..|..:| .||:.   |:..:|:|...: ...:|..::|     |:.    ||||..
  Fly    19 TRVDCEHVPLCSIND-VQLRF---LVPDDLTEVRQL-CQEWFPIDYPLSWYEDITSSTRFFALAA 78

  Fly   101 D---RYVGVIVCKLEAKRD---------------------------GYLQ---------GYIAML 126
            .   ..:|:||.:::..|:                           |.|.         |||..|
  Fly    79 VYNLAIIGLIVAEIKPYRNVNKEVIANMSDSDELYTRLSGFPMQDKGILPDSMGRSADVGYILSL 143

  Fly   127 AVDAEYRKRGIGRALSEMAIDAMAIRD---AAMIVLETELSNKPALALYQSLGFIRERRFLRYYL 188
            .|...:|:.|||..|.:..::.:...:   ...|.|.|..:|:||:..|:...|.. ..||.||.
  Fly   144 GVHRSHRRNGIGSLLLDALMNHLTTAERHSVKAIFLHTLTTNQPAIFFYEKRRFTL-HSFLPYYY 207

  Fly   189 N----GMDAF 194
            |    |.|.|
  Fly   208 NIRGKGKDGF 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30BNP_728606.1 rimI 70..194 CDD:273701 40/178 (22%)
Acetyltransf_1 99..177 CDD:278980 23/119 (19%)
Naa60NP_996032.1 RimI 74..207 CDD:223532 30/133 (23%)
Acetyltransf_1 <136..198 CDD:278980 17/61 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.