DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30B and Naa60

DIOPT Version :9

Sequence 1:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_008765741.1 Gene:Naa60 / 363545 RGDID:1308915 Length:295 Species:Rattus norvegicus


Alignment Length:178 Identity:42/178 - (23%)
Similarity:64/178 - (35%) Gaps:45/178 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KSEGIHFCVF-----------------HDESQLKVLMGLIDKELSEPYSIYTYRYFVYNWPDLCF 95
            |..||| ||.                 .|.:.::.|:.::..|:.|   :...:..|....|:..
  Rat    79 KETGIH-CVLAGLKLRPACLCLSSAGVQDRAPMRGLLEVVSLEVKE---VSLKQQLVGRDGDILA 139

  Fly    96 FALDGDRYVGVIVCKLEAKRDGYLQGYIAMLAVDAEYRKRGIGRALSEMA---IDAMAIRDAAMI 157
            .:...|..|                .||..|.|..|:||.|||..|.|..   |...|......|
  Rat   140 SSFSVDTQV----------------AYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAI 188

  Fly   158 VLETELSNKPALALYQSLGFIRERRFLRYY--LNGM--DAFHLKLMLH 201
            .|....:|..|:..|::..| |:..:|.||  :.|:  |.|...|.::
  Rat   189 YLHVLTTNNTAINFYENRDF-RQHHYLPYYYSIRGVLKDGFTYVLYIN 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30BNP_728606.1 rimI 70..194 CDD:273701 32/130 (25%)
Acetyltransf_1 99..177 CDD:278980 21/80 (26%)
Naa60XP_008765741.1 Acetyltransf_1 <137..208 CDD:395465 21/86 (24%)
TIM <192..>256 CDD:419668 12/45 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.