DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30B and Naa20B

DIOPT Version :9

Sequence 1:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001285885.1 Gene:Naa20B / 318982 FlyBaseID:FBgn0051851 Length:204 Species:Drosophila melanogaster


Alignment Length:142 Identity:40/142 - (28%)
Similarity:66/142 - (46%) Gaps:11/142 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LSEPYSIYTYRYFVYNWPDLCFFALDGDR-YVGVIV-CKLE--------AKRDGYLQGYIAMLAV 128
            |:|.||:......:...|:|...|...|. .:|.|: .::|        ||...:..|:|:.|||
  Fly    23 LAEVYSLPFLLPKILEHPELVLAADAPDNSLMGFILGTRVEDATESFGDAKTMTWNHGHISALAV 87

  Fly   129 DAEYRKRGIGRALSEMAIDAMAIRDAAMIVLETELSNKPALALYQSLGFIRERRFLRYYLNGMDA 193
            ..:|||.|:|..|.....|.|..:....|.|.....|..|:.||:|||:::.|...::|.:. ..
  Fly    88 AQDYRKLGLGTRLLTTVRDMMDRQKDFYIDLFVREKNTIAIGLYESLGYVKYRWIPKFYADD-HG 151

  Fly   194 FHLKLMLHDFID 205
            :.::|.|...:|
  Fly   152 YEMRLPLSSDVD 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30BNP_728606.1 rimI 70..194 CDD:273701 37/129 (29%)
Acetyltransf_1 99..177 CDD:278980 27/87 (31%)
Naa20BNP_001285885.1 RimI <27..158 CDD:223532 36/131 (27%)
Acetyltransf_1 50..137 CDD:278980 28/86 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466526
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.