DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30B and CG31730

DIOPT Version :9

Sequence 1:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_723799.1 Gene:CG31730 / 318920 FlyBaseID:FBgn0051730 Length:162 Species:Drosophila melanogaster


Alignment Length:123 Identity:39/123 - (31%)
Similarity:62/123 - (50%) Gaps:5/123 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LIDKELSEPYSIYTYRYFVYNWPDLCFFAL----DGDRYVGVIVCKLEAKRDGYLQGYIAMLAVD 129
            |:...|:|.||:..:......:|.|...|:    || |.:|.|..:.:.||:....|::|.|.|.
  Fly    18 LVFDALTEVYSLTFFVKHFLEFPGLSQIAIAPGPDG-RPMGYIFGQYQVKRNQDPYGHVAALTVS 81

  Fly   130 AEYRKRGIGRALSEMAIDAMAIRDAAMIVLETELSNKPALALYQSLGFIRERRFLRYY 187
            .|||:.|:..||.:.......::.|:.:.|...:||:.|..||.|||:...:.||.||
  Fly    82 PEYRRLGLATALMDFFFMVSDLKGASYVNLFMRISNRAAYQLYTSLGYAHRQTFLDYY 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30BNP_728606.1 rimI 70..194 CDD:273701 38/122 (31%)
Acetyltransf_1 99..177 CDD:278980 26/77 (34%)
CG31730NP_723799.1 rimI 9..141 CDD:273701 39/123 (32%)
Acetyltransf_1 52..129 CDD:278980 26/77 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466527
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.