DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30B and Nat8l

DIOPT Version :9

Sequence 1:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001178610.1 Gene:Nat8l / 289727 RGDID:1305719 Length:299 Species:Rattus norvegicus


Alignment Length:181 Identity:41/181 - (22%)
Similarity:74/181 - (40%) Gaps:49/181 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VTKNLPL--------------FAEKIVLPENDTAAKSEGIHFCVFHDESQLKVLMGLIDKELSEP 77
            ||::|.|              ::.|::|...:          |..|.:      |..|::...:|
  Rat   128 VTRSLLLTCLVPAGLLALRYYYSRKVILAYLE----------CALHTD------MADIEQYYMKP 176

  Fly    78 YSIYTYRYFVYNWPDLCFF--ALDGDRYVGVIVCKLEAKRDGYLQGYIAMLAVDAEYRKRGIGRA 140
                         |..||:  .|||: .||::..:.. :.|..::  :..::||:.:|.:||.:|
  Rat   177 -------------PGSCFWVAVLDGN-VVGIVAARAH-EEDNTVE--LLRMSVDSRFRGKGIAKA 224

  Fly   141 LSEMAIDAMAIRDAAMIVLETELSNKPALALYQSLGFIRERRFLRYYLNGM 191
            |....::...:.:.:.:||.|......|..||:||||........|.|.||
  Rat   225 LGRRVLEFAMLHNYSAVVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGM 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30BNP_728606.1 rimI 70..194 CDD:273701 32/124 (26%)
Acetyltransf_1 99..177 CDD:278980 20/77 (26%)
Nat8lNP_001178610.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..70
Acetyltransf_1 151..261 CDD:395465 31/142 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.