DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Naa30B and Kat14

DIOPT Version :9

Sequence 1:	NP_728606.1	Gene:	Naa30B / 317976	FlyBaseID:	FBgn0052319	Length:	211	Species:	Drosophila melanogaster
Sequence 2:	NP_852082.2	Gene:	Kat14 / 228714	MGIID:	1917264	Length:	779	Species:	Mus musculus

Alignment Length:	89	Identity:	29/89 - (32%)
Similarity:	40/89 - (44%)	Gaps:	12/89 - (13%)

- Green bases have known domain annotations that are detailed below.

  Fly   118 YLQGYIAMLAVDAEYRKRGIGRALSEMAIDAMAIRDAAMIVLETELSNKPALALYQSLGFIRERR 182
            |.:.||:.|.|..|:|:.||...:....|.....:|   :.|....|| ||:.|||..||..|..
Mouse   693 YNEAYISFLLVHPEWRRAGIATFMIYHLIQTCMGKD---VTLHVSASN-PAMLLYQKFGFKTEEY 753

  Fly   183 FLRYY-----LNGMD---AFHLKL 198
            .|.:|     |...:   ||.|:|
Mouse   754 VLDFYDKYYPLESTECKHAFFLRL 777

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Naa30B	NP_728606.1	rimI	70..194	CDD:273701	25/83 (30%)
Naa30B	NP_728606.1	Acetyltransf_1	99..177	CDD:278980	19/58 (33%)
Kat14	NP_852082.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..34
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	247..292
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	314..345
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	360..457
		RimI	648..760	CDD:223532	24/70 (34%)
		Acetyltransf_1	680..749	CDD:278980	20/59 (34%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0456
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900