DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30B and F16B12.1

DIOPT Version :9

Sequence 1:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001359593.1 Gene:F16B12.1 / 181519 WormBaseID:WBGene00008879 Length:686 Species:Caenorhabditis elegans


Alignment Length:120 Identity:24/120 - (20%)
Similarity:38/120 - (31%) Gaps:48/120 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IVLPENDTAAKSEGIHFCVFHDESQLKVLMGLIDKELSEPYS---------------IYTY-RYF 86
            :::.:.|.:....|     ||..:....|..|.|.:.|..|:               ||.| :|.
 Worm   592 LIMFQTDQSISDRG-----FHITATAHYLRDLYDGDNSLTYALIALALVFIIAILLVIYVYEKYL 651

  Fly    87 VYNWPDLCFF--ALDGDRYVGVIVCKLEAKRDGYLQGYIAMLAVDAEYRKRGIGR 139
            ..:.|.:...  |..||.:        ||.||                 :|.:||
 Worm   652 AKDAPRIAIAHGAGGGDNF--------EAARD-----------------ERNLGR 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30BNP_728606.1 rimI 70..194 CDD:273701 18/88 (20%)
Acetyltransf_1 99..177 CDD:278980 9/41 (22%)
F16B12.1NP_001359593.1 CUB 24..118 CDD:214483
CUB 515..612 CDD:238001 4/24 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.