DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30B and daf-31

DIOPT Version :9

Sequence 1:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_501392.1 Gene:daf-31 / 177622 WormBaseID:WBGene00000923 Length:182 Species:Caenorhabditis elegans


Alignment Length:127 Identity:39/127 - (30%)
Similarity:61/127 - (48%) Gaps:3/127 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LSEPYSIYTYRYFVYNWPDLCFFALD-GDRYVGVIVCKLEAKRDGYLQGYIAMLAVDAEYRKRGI 137
            |.|.|.:..|.|...:||.|.:.|.| ....||.::.|:|........|:|..|||...||:.|:
 Worm    22 LPENYQMKYYFYHALSWPQLSYIAEDHKGNVVGYVLAKMEEDPGEEPHGHITSLAVKRSYRRLGL 86

  Fly   138 GRALSEMAIDAMA-IRDAAMIVLETELSNKPALALYQ-SLGFIRERRFLRYYLNGMDAFHLK 197
            ...:.:....||. ..:|..:.|...:||:.||.||: :|.|.......:||.:|.||:.::
 Worm    87 ANKMMDQTARAMVETYNAKYVSLHVRVSNRAALNLYKNTLKFEIVDTEPKYYADGEDAYAMR 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30BNP_728606.1 rimI 70..194 CDD:273701 38/122 (31%)
Acetyltransf_1 99..177 CDD:278980 24/80 (30%)
daf-31NP_501392.1 RimI 1..153 CDD:223532 39/127 (31%)
Acetyltransf_1 47..123 CDD:278980 22/75 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.