DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30B and F54E7.9

DIOPT Version :9

Sequence 1:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_498219.1 Gene:F54E7.9 / 175784 WormBaseID:WBGene00018831 Length:167 Species:Caenorhabditis elegans


Alignment Length:162 Identity:34/162 - (20%)
Similarity:66/162 - (40%) Gaps:15/162 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CVFHD----ESQLKVLMGLIDKELSEPYSIYTYRYFVYNWPDLCFFALDGDRYVGVIVCKLEA-- 113
            |:.|.    ::.|::.:..:..|..:...|.....|..::.|..:.....:...||::...||  
 Worm     6 CLSHSSPSTDNSLELRLQRVTAENIKTVRILVSSIFPVSYSDKFYQECMNNELTGVVIRNGEAIA 70

  Fly   114 ----KRDGYLQG---YIAMLAVDAEYRKRGIGRALSEMAIDAMAIRDAAMIVLETELSNKPALAL 171
                |.:.:..|   ||....|...:|:.|:|..|.:...:...:......:|..:.|||.|:..
 Worm    71 IVAVKPENFETGRVLYIRSFGVHPRHREAGLGSFLMDFVDEKGKLLKLPHAMLHVQTSNKTAIEF 135

  Fly   172 YQSLGFIRERRFLRYY--LNGMDAFHLKLMLH 201
            |::.||..:....:||  .:..|||.::...|
 Worm   136 YKNRGFNVDCLVPQYYQRCSPPDAFIMRKPFH 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30BNP_728606.1 rimI 70..194 CDD:273701 28/134 (21%)
Acetyltransf_1 99..177 CDD:278980 19/86 (22%)
F54E7.9NP_498219.1 Acetyltransf_1 30..141 CDD:366181 22/110 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.