DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30B and Nat8b

DIOPT Version :9

Sequence 1:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_598242.1 Gene:Nat8b / 171084 RGDID:621605 Length:222 Species:Rattus norvegicus


Alignment Length:195 Identity:43/195 - (22%)
Similarity:73/195 - (37%) Gaps:40/195 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ELSDKDSQEKMDLVTKN----LP-LFAEKIVLPENDTAAKSEGIHF--------------CVFHD 59
            |..|.|.:..:|:.||.    :| .|...::||.  |.....|:..              |:|..
  Rat     8 EYQDSDYKSVVDVFTKGAEEYIPSTFRHLLLLPR--TLLLLLGVSLALVLVSGSWLLAVVCIFFL 70

  Fly    60 ESQLKVLMGLIDKELSEPYSIYTYRYFVYNWPDLC-----------FFALDGDRYVGVI-VCKLE 112
            ...|..|.|       :|:..|..:....:..|:.           :.|..|::.||.: ...::
  Rat    71 LPFLWFLAG-------QPWKNYVSKCLHTDMADITKSYLSDRGSGFWVAESGEQVVGTVGALPVK 128

  Fly   113 AKRDGYLQGYIAMLAVDAEYRKRGIGRALSEMAIDAMAIRDAAMIVLETELSNKPALALYQSLGF 177
            ....|..|..:..|||.:::|.:||.:||....:.....:....:||||......|:.||..:||
  Rat   129 EPPSGRKQLQLFHLAVSSQHRGQGIAKALVRTVLQFARDQGYTDVVLETSTMQIGAVTLYLGMGF 193

  Fly   178  177
              Rat   194  193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30BNP_728606.1 rimI 70..194 CDD:273701 26/120 (22%)
Acetyltransf_1 99..177 CDD:278980 20/78 (26%)
Nat8bNP_598242.1 hydrophobic domain 36..80 9/52 (17%)
Acetyltransf_1 91..193 CDD:395465 22/101 (22%)
consensus motif D 109..126 4/16 (25%)
consensus motif A 131..166 10/34 (29%)
consensus motif B 174..194 9/20 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.