DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30B and NAA30

DIOPT Version :9

Sequence 1:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001011713.2 Gene:NAA30 / 122830 HGNCID:19844 Length:362 Species:Homo sapiens


Alignment Length:195 Identity:92/195 - (47%)
Similarity:126/195 - (64%) Gaps:15/195 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ELSDKDSQEKMDLVTKNL--------PLFAEKIVLPENDTAAKSEGIHFCVFHDESQLKVLMGLI 70
            |..:::..|::.|::.:|        |...|  |.|..|..     |.:..:..|.|:..:|.||
Human   174 EQEEEEEDEQVRLLSSSLTADCSLRSPSGRE--VEPGEDRT-----IRYVRYESELQMPDIMRLI 231

  Fly    71 DKELSEPYSIYTYRYFVYNWPDLCFFALDGDRYVGVIVCKLEAKRDGYLQGYIAMLAVDAEYRKR 135
            .|:|||||||||||||::|||.|||.|:.|:..||.|||||:..:..:.:|||||||||::||:.
Human   232 TKDLSEPYSIYTYRYFIHNWPQLCFLAMVGEECVGAIVCKLDMHKKMFRRGYIAMLAVDSKYRRN 296

  Fly   136 GIGRALSEMAIDAMAIRDAAMIVLETELSNKPALALYQSLGFIRERRFLRYYLNGMDAFHLKLML 200
            |||..|.:.||.||...|...:|||||::||.||.||::|||:|::|..||||||:||..|||.|
Human   297 GIGTNLVKKAIYAMVEGDCDEVVLETEITNKSALKLYENLGFVRDKRLFRYYLNGVDALRLKLWL 361

  Fly   201  200
            Human   362  361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30BNP_728606.1 rimI 70..194 CDD:273701 73/123 (59%)
Acetyltransf_1 99..177 CDD:278980 40/77 (52%)
NAA30NP_001011713.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..88
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..182 1/7 (14%)
RimI 209..362 CDD:223532 84/158 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157584
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S678
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1323575at2759
OrthoFinder 1 1.000 - - FOG0002360
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101962
Panther 1 1.100 - - O PTHR45896
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3472
SonicParanoid 1 1.000 - - X2923
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.690

Return to query results.
Submit another query.