DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30B and Nat8f5

DIOPT Version :9

Sequence 1:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_543160.1 Gene:Nat8f5 / 114020 RGDID:621610 Length:227 Species:Rattus norvegicus


Alignment Length:196 Identity:44/196 - (22%)
Similarity:81/196 - (41%) Gaps:37/196 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KELSDKDSQEKMDL----VTKNLP-LFAEKIVLPEN--------DTAAKSEGIHF----CVFHDE 60
            ::..::|.:..:||    :.:::| .|...::||:.        .|...:.|...    |:|...
  Rat     7 RQYQERDHKHVVDLFSSGIKEHIPAAFRYTLLLPKTLLFLFAAPLTIVLASGSWLLAVVCIFFLL 71

  Fly    61 SQLKVLMGLIDKELSEPYSIYTYRYFVYNWPDLC----------FFALDGDRYVGVIVCKLEAKR 115
            ..|:.|.|       :|:..|.......:..|:.          :.|..|.:.|| ||..|..|.
  Rat    72 LLLRFLAG-------QPFKEYVAMCLQTDMADITKSYLNAHGSFWVAESGGQVVG-IVAALPVKE 128

  Fly   116 --DGYLQGYIAMLAVDAEYRKRGIGRALSEMAIDAMAIRDAAMIVLETELSNKPALALYQSLGFI 178
              .|..|..:..|:|.::.|.:||.:||....:.....:....:||||.:..:.|:.||:::||.
  Rat   129 SPSGRKQLQLFHLSVSSQCRGQGIAKALVRTVLQFARDQGYMDVVLETSIIQQGAMTLYEAMGFQ 193

  Fly   179 R 179
            |
  Rat   194 R 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30BNP_728606.1 rimI 70..194 CDD:273701 30/122 (25%)
Acetyltransf_1 99..177 CDD:278980 23/79 (29%)
Nat8f5NP_543160.1 RimI <101..196 CDD:223532 27/95 (28%)
NAT_SF 108..175 CDD:173926 18/67 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0456
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.