Sequence 1: | NP_728606.1 | Gene: | Naa30B / 317976 | FlyBaseID: | FBgn0052319 | Length: | 211 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_543160.1 | Gene: | Nat8f5 / 114020 | RGDID: | 621610 | Length: | 227 | Species: | Rattus norvegicus |
Alignment Length: | 196 | Identity: | 44/196 - (22%) |
---|---|---|---|
Similarity: | 81/196 - (41%) | Gaps: | 37/196 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 KELSDKDSQEKMDL----VTKNLP-LFAEKIVLPEN--------DTAAKSEGIHF----CVFHDE 60
Fly 61 SQLKVLMGLIDKELSEPYSIYTYRYFVYNWPDLC----------FFALDGDRYVGVIVCKLEAKR 115
Fly 116 --DGYLQGYIAMLAVDAEYRKRGIGRALSEMAIDAMAIRDAAMIVLETELSNKPALALYQSLGFI 178
Fly 179 R 179 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Naa30B | NP_728606.1 | rimI | 70..194 | CDD:273701 | 30/122 (25%) |
Acetyltransf_1 | 99..177 | CDD:278980 | 23/79 (29%) | ||
Nat8f5 | NP_543160.1 | RimI | <101..196 | CDD:223532 | 27/95 (28%) |
NAT_SF | 108..175 | CDD:173926 | 18/67 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0456 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |