DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Naa30B and naa30

DIOPT Version :9

Sequence 1:NP_728606.1 Gene:Naa30B / 317976 FlyBaseID:FBgn0052319 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_004917281.2 Gene:naa30 / 100379895 XenbaseID:XB-GENE-877040 Length:311 Species:Xenopus tropicalis


Alignment Length:158 Identity:83/158 - (52%)
Similarity:113/158 - (71%) Gaps:0/158 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 NDTAAKSEGIHFCVFHDESQLKVLMGLIDKELSEPYSIYTYRYFVYNWPDLCFFALDGDRYVGVI 107
            |..:...:.|.:..:..|.|:..:|.||.::|||||||||||||::|||.|||.|:.|:..||.|
 Frog   153 NHVSQGDDTIRYVRYESELQMPDIMRLITRDLSEPYSIYTYRYFIHNWPQLCFLAMVGEECVGAI 217

  Fly   108 VCKLEAKRDGYLQGYIAMLAVDAEYRKRGIGRALSEMAIDAMAIRDAAMIVLETELSNKPALALY 172
            ||||:..:..:.:|||||||||::||::|||..|.:.||.||...|...:|||||::||.||.||
 Frog   218 VCKLDMHKKMFRRGYIAMLAVDSKYRRKGIGTNLVKKAIYAMVEGDCDEVVLETEITNKSALKLY 282

  Fly   173 QSLGFIRERRFLRYYLNGMDAFHLKLML 200
            ::|||:|::|..||||||:||..|||.|
 Frog   283 ENLGFVRDKRLFRYYLNGVDALRLKLWL 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Naa30BNP_728606.1 rimI 70..194 CDD:273701 72/123 (59%)
Acetyltransf_1 99..177 CDD:278980 40/77 (52%)
naa30XP_004917281.2 RimI 161..311 CDD:223532 82/150 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 174 1.000 Inparanoid score I3962
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1323575at2759
OrthoFinder 1 1.000 - - FOG0002360
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45896
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3472
SonicParanoid 1 1.000 - - X2923
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.100

Return to query results.
Submit another query.