DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and Pi15

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_444421.2 Gene:Pi15 / 94227 MGIID:1934659 Length:269 Species:Mus musculus


Alignment Length:169 Identity:41/169 - (24%)
Similarity:60/169 - (35%) Gaps:57/169 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ILEAHNRRRAKY-----GNQPMVLDEELCTECSEYADEIVRNEGVYTENY-LEYLYATDPISAKH 85
            ||:.||:.|.|.     ..:.||.||.|......:|...:.:.|   .:| |.:|       .::
Mouse    81 ILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHG---PSYLLRFL-------GQN 135

  Fly    86 LQV-VCVFREALPRECVRIWFHYRGFAENTKYYRF----------------------TAMIWNAS 127
            |.| ...:|..|  :.|:.|:      :..|.|.|                      |.|:|..|
Mouse   136 LSVRTGRYRSIL--QLVKPWY------DEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMVWATS 192

  Fly   128 TRLGVGLGRIQETR----------YLVVRYAPPGNILRE 156
            .|:|..:...|...          |||..|||.||.:.|
Mouse   193 NRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGE 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 39/164 (24%)
Pi15NP_444421.2 SCP_euk 80..223 CDD:240180 35/159 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841204
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.