DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and PRY2

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_012938.3 Gene:PRY2 / 853882 SGDID:S000001721 Length:329 Species:Saccharomyces cerevisiae


Alignment Length:148 Identity:35/148 - (23%)
Similarity:62/148 - (41%) Gaps:31/148 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ILEAHNRRRAKYGNQ-PMVLDEELCTECSEYAD------EIVRNEGVYTENYLEYLYATDPISAK 84
            ::..||.:||.:.:. .:...:.|.|....|||      .:|.:.|.|.||.......|..:.|.
Yeast   196 MVNEHNTKRALHKDTGSLTWSDTLATYAQNYADSYDCSGNLVHSGGPYGENLALGYGTTGSVDAW 260

  Fly    85 HLQVVCVFREALPRECVRIWFHYR--GFAENTKYYRFTAMIWNASTRLGVGL----GRIQETRYL 143
            :.::..              :.|.  ||:|:..:  ||.::|..::.:|.||    |...:  |:
Yeast   261 YNEITS--------------YDYSNPGFSESAGH--FTQVVWKGTSEVGCGLKSCGGEWGD--YI 307

  Fly   144 VVRYAPPGNILREMASNV 161
            :..|...||::.|.|.||
Yeast   308 ICSYKAAGNVIGEFADNV 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 30/138 (22%)
PRY2NP_012938.3 CAP_PRY1-like 191..319 CDD:349403 31/140 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344524
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.800

Return to query results.
Submit another query.