DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and PRY1

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_012456.1 Gene:PRY1 / 853366 SGDID:S000003615 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:151 Identity:41/151 - (27%)
Similarity:66/151 - (43%) Gaps:33/151 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SLILEAHNRRRAKYGNQP-MVLDEELCTECSEYADE------IVRNEGVYTENY-LEYLYATDPI 81
            |.:|..||::||.:.:.| :...:.|.:...:|||.      :..:.|.|.||. |.|   ..|.
Yeast   164 SSVLAEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPYGENLALGY---DGPA 225

  Fly    82 SAKHLQVVCVFREALPRECVRIWFHYRGFAENTKYYRFTAMIWNASTRLGVGLGRIQET------ 140
            :.          :|...|.....|...||:.||.:  ||.::|.::|::|.|:    :|      
Yeast   226 AV----------DAWYNEISNYDFSNPGFSSNTGH--FTQVVWKSTTQVGCGI----KTCGGAWG 274

  Fly   141 RYLVVRYAPPGNILREMASNV 161
            .|::..|.|.||...|.|.||
Yeast   275 DYVICSYDPAGNYEGEYADNV 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 35/139 (25%)
PRY1NP_012456.1 CAP_PRY1-like 166..289 CDD:349403 36/141 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344522
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.800

Return to query results.
Submit another query.