DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and AT1G50060

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_175428.1 Gene:AT1G50060 / 841430 AraportID:AT1G50060 Length:161 Species:Arabidopsis thaliana


Alignment Length:170 Identity:37/170 - (21%)
Similarity:66/170 - (38%) Gaps:40/170 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FLIAIEVCNQTIGIGLRSL---ILEAHNRRRAKYGNQPMVLDEELCTECSEYAD------EIVRN 63
            ||:.:.:....:....::.   .|.:||..||:.|...:|.|..|......|::      .:|.:
plant     8 FLVIVAISFLVVATNAQNTPQDYLNSHNTARAQVGVPNVVWDTTLAAYALNYSNFRKADCNLVHS 72

  Fly    64 EGVYTENYLEYLYAT-DPISAKHLQVVCVFREALPRECVRIWFH---YRGFAENT-----KYYRF 119
            .|.|.||..:...:: ..|||                 |::|..   |..:|.|.     :...:
plant    73 NGPYGENLAKGSSSSFSAISA-----------------VKLWVDEKPYYSYAYNNCTGGKQCLHY 120

  Fly   120 TAMIWNASTRLGVGLGRIQETR---YLVVRYAPPGNILRE 156
            |.::|..|.:  :|..|:|.|.   ::...|..|||.:.|
plant   121 TQVVWRDSVK--IGCARVQCTNTWWFVSCNYNSPGNWVGE 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 33/143 (23%)
AT1G50060NP_175428.1 CAP_PR-1 27..161 CDD:349400 35/151 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.