DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32313 and AT5G26130

DIOPT Version :9

Sequence 1:NP_001261262.1 Gene:CG32313 / 317973 FlyBaseID:FBgn0052313 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_197985.2 Gene:AT5G26130 / 832682 AraportID:AT5G26130 Length:166 Species:Arabidopsis thaliana


Alignment Length:176 Identity:36/176 - (20%)
Similarity:64/176 - (36%) Gaps:59/176 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IILFLIAIEVCNQTIGIGLRSL-----ILEAHNRRRAKYGNQPMVLDEELCTECSEYADEIVR-- 62
            |:|||        ...:.|::.     .|:.|||.|.:.|..||    :......:||....:  
plant    15 IVLFL--------AFAVPLKAQDQPQDYLDEHNRARTQVGVPPM----KWHAGAEQYAWNYAQQR 67

  Fly    63 ----------NEGVYTENYLEYLYATDPISAKHLQVVCVFREALPRECVRIWFHYRG---FAENT 114
                      :.|:|.||   ..::...:|.              .|.|::|.:.:.   :|.||
plant    68 KGDCSLTHSNSNGLYGEN---LAWSGGALSG--------------AEAVKLWVNEKSDYIYASNT 115

  Fly   115 -----KYYRFTAMIWNASTRLGVGLGRIQ---ETRYLVVRYAPPGN 152
                 :...:|.::|..|.  .||..:::   ...::...|.||||
plant   116 CSDGKQCGHYTQVVWRTSE--WVGCAKVKCDNGGTFVTCNYYPPGN 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32313NP_001261262.1 SCP 27..153 CDD:294090 31/149 (21%)
AT5G26130NP_197985.2 CAP_PR-1 31..166 CDD:349400 31/152 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.